BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K02 (895 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0628 - 4731052-4731601,4731825-4732782,4733143-4733953,473... 29 6.6 >01_01_0628 - 4731052-4731601,4731825-4732782,4733143-4733953, 4734038-4734241,4734695-4734802,4735930-4736369, 4736463-4736541 Length = 1049 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +3 Query: 189 AAGLCFGSXQLXSYNQAPQHCXAFIYGGCQGXXNRF-STLAECXQKCIN*LIIS 347 A LCF N Q + Y GCQG + F ST+ K ++ ++ S Sbjct: 321 AGTLCFLQQTRSHQNMITQEGSSLTYNGCQGITSNFLSTVENAEDKFVHKIVTS 374 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,401,260 Number of Sequences: 37544 Number of extensions: 290242 Number of successful extensions: 567 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2518669100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -