BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J24 (900 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 3.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.6 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.0 bits (47), Expect = 3.8 Identities = 18/63 (28%), Positives = 25/63 (39%), Gaps = 6/63 (9%) Frame = -2 Query: 440 SFFRMSHNAIFAQVHVEHDFIA------GQYGNDHVDSINGCSNGVGWRHSVLGRCVQCI 279 +F RM N I Q+ + + A GQ G +D+I GW H + V C Sbjct: 322 NFDRMQGNPICVQIPWDKNVEALAKWANGQTGFPWIDAIMTQLREEGWIHHLARHAVACF 381 Query: 278 FGR 270 R Sbjct: 382 LTR 384 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 596 TTSGHEGQGSVLSTHDS 546 T SGH G G +L+ +D+ Sbjct: 1927 TGSGHGGHGGLLTPYDT 1943 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 260,233 Number of Sequences: 438 Number of extensions: 6148 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29146299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -