BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J23 (894 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC064495-1|AAH64495.1| 299|Homo sapiens RCOR1 protein protein. 32 3.2 BC051003-1|AAH51003.1| 293|Homo sapiens RCOR1 protein protein. 32 3.2 AF155595-1|AAF01498.1| 482|Homo sapiens CoREST protein protein. 32 3.2 AF137396-7|AAG41681.1| 326|Homo sapiens HOR5'Beta7 protein. 31 4.3 D88812-1|BAB46921.1| 729|Homo sapiens cerebral protein-6 protein. 31 7.5 D87462-1|BAA13401.2| 759|Homo sapiens KIAA0272 protein. 31 7.5 BC001596-1|AAH01596.1| 729|Homo sapiens BRCA1 associated protei... 31 7.5 AY130008-1|AAN05092.1| 566|Homo sapiens MU-MB-17.261 protein. 31 7.5 AF045581-1|AAC15970.1| 729|Homo sapiens BRCA1 associated protei... 31 7.5 >BC064495-1|AAH64495.1| 299|Homo sapiens RCOR1 protein protein. Length = 299 Score = 31.9 bits (69), Expect = 3.2 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = -3 Query: 697 EKGGQVSGKRQGRNRRAHEGASRGKRLVSL*SCRVSPPLT*AS 569 EKG +VSGKR+GRN A ++ + +C SP T AS Sbjct: 3 EKGPEVSGKRRGRNNAAASASAAAASAAASAAC-ASPAATAAS 44 >BC051003-1|AAH51003.1| 293|Homo sapiens RCOR1 protein protein. Length = 293 Score = 31.9 bits (69), Expect = 3.2 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = -3 Query: 697 EKGGQVSGKRQGRNRRAHEGASRGKRLVSL*SCRVSPPLT*AS 569 EKG +VSGKR+GRN A ++ + +C SP T AS Sbjct: 3 EKGPEVSGKRRGRNNAAASASAAAASAAASAAC-ASPAATAAS 44 >AF155595-1|AAF01498.1| 482|Homo sapiens CoREST protein protein. Length = 482 Score = 31.9 bits (69), Expect = 3.2 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = -3 Query: 697 EKGGQVSGKRQGRNRRAHEGASRGKRLVSL*SCRVSPPLT*AS 569 EKG +VSGKR+GRN A ++ + +C SP T AS Sbjct: 3 EKGPEVSGKRRGRNNAAASASAAAASAAASAAC-ASPAATAAS 44 >AF137396-7|AAG41681.1| 326|Homo sapiens HOR5'Beta7 protein. Length = 326 Score = 31.5 bits (68), Expect = 4.3 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +2 Query: 641 LVRSPVPTLPLTGYLSAFLPSGSVALSHS 727 + R PV T+P+ L AF GSV LSHS Sbjct: 161 IFRGPVATIPIVLLLKAFPYCGSVVLSHS 189 >D88812-1|BAB46921.1| 729|Homo sapiens cerebral protein-6 protein. Length = 729 Score = 30.7 bits (66), Expect = 7.5 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +2 Query: 626 PPGSSLVR-SPVPTLPLTGYLSAFLPSGSVALSHSSRCXYLSSGVGRS 766 PPGSSL P PT P+ L AFL + + A S L++GVGRS Sbjct: 338 PPGSSLNGVHPNPT-PIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRS 384 >D87462-1|BAA13401.2| 759|Homo sapiens KIAA0272 protein. Length = 759 Score = 30.7 bits (66), Expect = 7.5 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +2 Query: 626 PPGSSLVR-SPVPTLPLTGYLSAFLPSGSVALSHSSRCXYLSSGVGRS 766 PPGSSL P PT P+ L AFL + + A S L++GVGRS Sbjct: 368 PPGSSLNGVHPNPT-PIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRS 414 >BC001596-1|AAH01596.1| 729|Homo sapiens BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) protein. Length = 729 Score = 30.7 bits (66), Expect = 7.5 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +2 Query: 626 PPGSSLVR-SPVPTLPLTGYLSAFLPSGSVALSHSSRCXYLSSGVGRS 766 PPGSSL P PT P+ L AFL + + A S L++GVGRS Sbjct: 338 PPGSSLNGVHPNPT-PIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRS 384 >AY130008-1|AAN05092.1| 566|Homo sapiens MU-MB-17.261 protein. Length = 566 Score = 30.7 bits (66), Expect = 7.5 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +2 Query: 626 PPGSSLVR-SPVPTLPLTGYLSAFLPSGSVALSHSSRCXYLSSGVGRS 766 PPGSSL P PT P+ L AFL + + A S L++GVGRS Sbjct: 175 PPGSSLNGVHPNPT-PIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRS 221 >AF045581-1|AAC15970.1| 729|Homo sapiens BRCA1 associated protein 1 protein. Length = 729 Score = 30.7 bits (66), Expect = 7.5 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +2 Query: 626 PPGSSLVR-SPVPTLPLTGYLSAFLPSGSVALSHSSRCXYLSSGVGRS 766 PPGSSL P PT P+ L AFL + + A S L++GVGRS Sbjct: 338 PPGSSLNGVHPNPT-PIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRS 384 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,300,292 Number of Sequences: 237096 Number of extensions: 2413328 Number of successful extensions: 11062 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11061 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11492727354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -