BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J22 (893 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0686 - 30900748-30902167,30903442-30904742 39 0.005 07_01_0080 + 587674-588510 35 0.076 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 34 0.13 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 34 0.13 03_06_0599 + 34984869-34985319,34986581-34987563 34 0.18 07_03_1573 + 27829967-27830338,27830821-27831510,27831594-278317... 33 0.31 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 33 0.31 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 32 0.54 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 32 0.71 07_03_0559 + 19475893-19476783 32 0.71 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 32 0.71 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 32 0.71 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 31 0.94 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 31 0.94 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 31 0.94 07_03_1136 + 24218601-24218734,24218769-24219906 31 1.6 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 31 1.6 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 30 2.2 06_02_0282 + 13720419-13720985 30 2.2 06_02_0257 - 13533689-13533714,13533799-13533925,13534013-135341... 30 2.2 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 30 2.9 09_02_0327 - 7284829-7284889,7284946-7286126 30 2.9 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 30 2.9 08_02_1256 + 25645085-25645396 29 3.8 07_03_1751 - 29215074-29216270 29 3.8 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 29 3.8 07_03_0890 - 22332768-22333382 29 3.8 07_03_0560 + 19479597-19480667 29 3.8 07_03_0558 + 19461369-19462448 29 3.8 07_03_0177 - 14770777-14772045 29 3.8 06_02_0046 + 10928708-10928798,10929997-10930077,10930567-109306... 29 3.8 06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700,336... 29 3.8 03_02_0765 + 11000724-11002496 29 3.8 01_02_0031 + 10364487-10365407 29 3.8 01_01_0570 - 4231100-4232560 29 3.8 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 29 5.0 06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-38... 29 5.0 01_05_0433 - 22094784-22095659 29 5.0 12_02_1174 - 26696869-26698191 29 6.6 09_06_0283 + 22024779-22026134,22026181-22026714 29 6.6 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 29 6.6 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 29 6.6 07_03_1636 + 28290642-28291574 29 6.6 07_01_0479 + 3606663-3607448 29 6.6 04_01_0197 + 2323790-2324098,2324145-2324774 29 6.6 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 29 6.6 03_05_0067 - 20460206-20460703,20461255-20461530 29 6.6 03_01_0515 - 3864796-3865425 29 6.6 02_05_0142 - 26227792-26228346,26228486-26228608,26229824-262300... 29 6.6 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 29 6.6 01_07_0081 - 40959279-40959375,40959463-40959589,40960138-409603... 29 6.6 01_03_0270 + 14445240-14445464,14445490-14445655,14446193-144463... 29 6.6 01_03_0005 + 11568545-11569119,11569179-11569191 29 6.6 01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536,787... 29 6.6 11_01_0359 - 2731522-2732346 28 8.7 09_06_0172 + 21329904-21331512,21331595-21331740,21332333-213325... 28 8.7 09_03_0145 - 12749288-12751510 28 8.7 08_01_0059 - 394001-394708 28 8.7 07_01_0516 - 3850252-3852870 28 8.7 06_03_0425 - 20659298-20659634,20659964-20660075,20660161-20660272 28 8.7 03_05_0843 + 28126480-28127007,28127092-28127457,28129388-281294... 28 8.7 03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468,593... 28 8.7 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 28 8.7 02_04_0021 + 18975992-18976408 28 8.7 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPPXKXXXPXXXPPG 365 G P PPP G PPPPP P PPG Sbjct: 343 GPPPPPPAKGPPPPPPPKGPSPPPPPPPG 371 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/76 (27%), Positives = 22/76 (28%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXPXIXXXXXXXXPGXXXKXGXPKKXXPXXXXGXXP 259 P P PPPP K PP P+G P P P P G P Sbjct: 319 PKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPP 378 Query: 258 XGXXKXXGGXPPPXXG 211 K PP G Sbjct: 379 PPPPKGGASRPPAAPG 394 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G P PPP G PPPPP PP Sbjct: 352 GPPPPPPPKGPSPPPPPPPGGKKGGPPP 379 Score = 32.7 bits (71), Expect = 0.40 Identities = 25/80 (31%), Positives = 25/80 (31%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPGXSXNFXXXXXXXPXXXXXKXGPXKXXPXXXFXX 266 P P P PPPPP K P P G P GP P Sbjct: 317 PPPKPAAAAPPPPPPPKAAPPPPPPKGPP---PPPPAKGPPPPPPPKGPSPPPP------ 367 Query: 265 XXXGGXXKXXGXPPPXXGGG 206 GG K G PPP GG Sbjct: 368 PPPGG--KKGGPPPPPPKGG 385 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPP--XKXXXPXXXPP 368 G P PPP PPPPP K P PP Sbjct: 352 GPPPPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 511 PPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPP 407 PP P G GG P PPP G PP Sbjct: 356 PPPPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPP 390 >07_01_0080 + 587674-588510 Length = 278 Score = 35.1 bits (77), Expect = 0.076 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP G PPPPP P PP Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPPPPP 120 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 94 PPPPPPSSGSPPPPPPPPPPPPPPPP 119 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 93 PPPPPPPSSGSPPPPPPPPPPPPPPP 118 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPP 401 G P PPP PPPPP Sbjct: 102 GSPPPPPPPPPPPPPPPP 119 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP K P PP Sbjct: 365 PPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPP 378 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPR 367 PPP PPPP K PP P+ Sbjct: 368 PPPPRPPPPPPPIKKGAPPPAPPK 391 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP PP +G P Sbjct: 359 PPPPPPPPPPPPPRPPPPPPPIKKGAP 385 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 34.3 bits (75), Expect = 0.13 Identities = 23/74 (31%), Positives = 25/74 (33%), Gaps = 5/74 (6%) Frame = +1 Query: 208 PPPXXGGGP---PXXFXXPPGXXPXXXX--GGXFFXXPXFXXXPXXXXXPXXXNXGXPPG 372 PP GGGP P + PP P GG P + P G PP Sbjct: 339 PPSSYGGGPGSYPPSYGAPPPNPPYSGGAPGGQGSLPPSYDGGYGGRPMPGGGGPGAPPP 398 Query: 373 XXXGGXXFXXGGGG 414 GG GGGG Sbjct: 399 YHGGGGGGGGGGGG 412 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GG+ G + GGGGG+ GG G Sbjct: 69 GGYGGGGGGYGGGGGGYGGGGRGGGG 94 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G P PPP PPPPP + P PP Sbjct: 395 GPAPPPPPQPPPPPPPPPHQRETPSPSPP 423 >07_03_1573 + 27829967-27830338,27830821-27831510,27831594-27831781, 27832286-27832318,27832364-27832605,27833178-27833320, 27833649-27833825,27834104-27834256,27834639-27834694, 27834998-27835157,27835301-27835348 Length = 753 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPG 365 P P P PPPPP + P PPG Sbjct: 26 PKPTPIRNPTPPPPPPRRRTPPPPPPG 52 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP + P PP Sbjct: 358 PPPPPFAPTLPPPPPPRRKPPSPSPP 383 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXPXI 352 PPP PPPP + PP P P I Sbjct: 360 PPPFAPTLPPPPPPRRKPPSPSPPSSPLI 388 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -2 Query: 439 PPPXXGXXPPPPPXKXXXPXXXPPGXSXNF 350 PPP PPPPP P PP + +F Sbjct: 437 PPPPESTSPPPPPTSDPPPVPPPPPTTGSF 466 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPP 450 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 429 PLPPPPPPPPPPPPPLPPNMPPPLPP 454 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPGXSXN 353 P PPP PPP P P PP N Sbjct: 431 PPPPPPPPPPPPPLPPNMPPPLPPPPEPELN 461 >07_03_0559 + 19475893-19476783 Length = 296 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GGF G GGGGGF GGG G Sbjct: 71 GGFRGGGGGGLGGGGGFGGGGGGGLG 96 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GG G GGGGGF GGG G Sbjct: 111 GGSGAGGGLGGGGGGGFGGGSGGGVG 136 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GG G GGGGGF GGG G Sbjct: 153 GGSGTGGGLGGGGGGGFGGGGGGGIG 178 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 529 GGXGKXPPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPPG 365 GG PP P G P PP G PPPPP P PPG Sbjct: 1180 GGVAPPPPPPRGHGGVGGPPTPPGAPAPPMPPGVPG-GPPPPPGGRGLP--APPG 1231 Score = 31.5 bits (68), Expect = 0.94 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = -2 Query: 529 GGXGKXPPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 GG PP GG P P G PPPPP + PP Sbjct: 1146 GGVPPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPP 1199 Score = 31.1 bits (67), Expect = 1.2 Identities = 23/82 (28%), Positives = 24/82 (29%) Frame = -1 Query: 455 GGXXXXPPXXXXKXPPPPXKXXXPPXKXPGGXPKFXXXGXXXXXGXXXKXGXXKKXPPXX 276 GG PP PP P PP GG P G + PP Sbjct: 1146 GGVPPPPPVGGLGGPPAPP----PPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPPTP 1201 Query: 275 FXGKXPGGXXKXXGGPPPXXGG 210 P GGPPP GG Sbjct: 1202 PGAPAPPMPPGVPGGPPPPPGG 1223 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/80 (26%), Positives = 21/80 (26%), Gaps = 2/80 (2%) Frame = -2 Query: 454 GGXPXPPPXXGXX--PPPPPXKXXXPXXXPPGXSXNFXXXXXXXPXXXXXKXGPXKXXPX 281 G P PPP G PPPPP PP P GP P Sbjct: 1107 GAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPP 1166 Query: 280 XXFXXXXXGGXXKXXGXPPP 221 F PPP Sbjct: 1167 AGFRGGTPPPNAHGGVAPPP 1186 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = -2 Query: 511 PPXPXXXXXXXGXKXGXXXGGXPXPPP--XXGXXPPPPPXKXXXPXXXPP 368 PP P G + G P PP G PPPP P PP Sbjct: 1065 PPPPQRENTSVGIQGGIPPLPPPLPPTLGDYGVAPPPPSIGAGAPPPPPP 1114 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 453 GGXXXPPPXXXKXPPPPRXKXXPPXXXPRGXP 358 GG PPP PPPP+ PP P G P Sbjct: 262 GGPPRPPPPQVP-PPPPQAPPPPPPNAPMGMP 292 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 31.5 bits (68), Expect = 0.94 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P P P PPPPP K P PP Sbjct: 616 PPPRPPGAPPPPPPPGKPGGPPPPPP 641 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 31.5 bits (68), Expect = 0.94 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P P P PPPPP K P PP Sbjct: 921 PPPRPPGAPPPPPPPGKPGGPPPPPP 946 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 208 PPPXXGGGPPXXFXXPPGXXPXXXXGG 288 PPP GGPP PPG P GG Sbjct: 933 PPPGKPGGPPPP-PPPPGSLPRNLAGG 958 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 31.5 bits (68), Expect = 0.94 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 351 PPPPPPPPPPPPPPPKLNTAPKPPPP 376 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP K PP Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPPP 375 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPP 374 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 405 GGGGFXPXXGGGXGXPPXXXP 467 GGGG P GGG G PP P Sbjct: 102 GGGGARPPGGGGGGGPPSLPP 122 Score = 29.5 bits (63), Expect = 3.8 Identities = 23/81 (28%), Positives = 24/81 (29%), Gaps = 3/81 (3%) Frame = +2 Query: 206 PPPXXGGGXPPXFXXXPXGXX---PKXXXGXXFXGXPFXXXXPGXXXXXXXKIXGXPRGX 376 PP GGG PP G P G G P G + G RG Sbjct: 108 PPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGG 167 Query: 377 XXGGXXFXRGGGGXXXXXGGG 439 G GGGG GG Sbjct: 168 ALGRPPGGGGGGGGPGRAPGG 188 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP K P P Sbjct: 589 PSPPPAPKAAPPPPPPKSTGPGPPRP 614 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = -2 Query: 517 KXPPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 + PP P G K P P G PPPPP PP Sbjct: 745 RNPPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPPLHGASGRPHPP 794 Score = 28.7 bits (61), Expect = 6.6 Identities = 20/75 (26%), Positives = 21/75 (28%), Gaps = 3/75 (4%) Frame = -3 Query: 435 PPXXXKXPPPPRXKXXPPXXXPRGXPXI--XXXXXXXXPGXXXK-XGXPKKXXPXXXXGX 265 PP PP P PP P P + PG K P P Sbjct: 618 PPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPPRSSSR 677 Query: 264 XPXGXXKXXGGXPPP 220 P G G PPP Sbjct: 678 TPTGAATSSKGPPPP 692 >06_02_0282 + 13720419-13720985 Length = 188 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = +3 Query: 402 GGGGGFXPXXGGGXGXPPXXXPXFXPXXXXXXXGFGGXXPXPPXKN 539 GGGGG+ P G G G GG P PP +N Sbjct: 17 GGGGGYAPAESGDDGGQGKLATATSVSYRPNPHGGGGHAPLPPPQN 62 >06_02_0257 - 13533689-13533714,13533799-13533925,13534013-13534121, 13534193-13534272,13534758-13534979,13536070-13536318, 13537032-13537484,13539834-13540556 Length = 662 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = -2 Query: 478 GXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPPGXSXNF 350 G G GG PP PPPPP PG + +F Sbjct: 45 GGGGGDRRGGFQLPPDAAPPPPPPPPPSSAAAGGGGPGMTTSF 87 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPR 367 PPP + PPPP PP PR Sbjct: 257 PPPQSVRPPPPPPPPPPPPPMPPR 280 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -2 Query: 511 PPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPP 401 PP K G P PPP PPPPP Sbjct: 31 PPLSPCPSPASSYKERIIFGAHPPPPPPPPPPPPPPP 67 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 29.9 bits (64), Expect = 2.9 Identities = 28/105 (26%), Positives = 28/105 (26%) Frame = -2 Query: 520 GKXPPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPPGXSXNFXXX 341 G PP P G G G P PPP P PPP P G Sbjct: 299 GHHPPPPHPLPPGAGAGAGT---GAPPPPPAHPAAPAPPP---PAPSPSAAGAGSGPPPP 352 Query: 340 XXXXPXXXXXKXGPXKXXPXXXFXXXXXGGXXKXXGXPPPXXGGG 206 GP P GG G PPP GG Sbjct: 353 PPPAAPAAPRPPGPGPGPPPPPGAAGRGGG-----GPPPPALPGG 392 >08_02_1256 + 25645085-25645396 Length = 103 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP + PP Sbjct: 64 PPPPPPLPSPPPPPPPQQQEEQSPPP 89 >07_03_1751 - 29215074-29216270 Length = 398 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GGF G GGGGG GGG G Sbjct: 113 GGFGGGKGGGLGGGGGLGGGGGGGAG 138 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 439 PPPXXGXXPPPPPXKXXXPXXXPP 368 PPP PPPPP P PP Sbjct: 47 PPPPQPTLPPPPPRTLPPPPPPPP 70 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPPR PP P P Sbjct: 48 PPPQPTLPPPPPRTLPPPPPPPPPQPP 74 >07_03_0890 - 22332768-22333382 Length = 204 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPP 401 G P PPP PPPPP Sbjct: 73 GSPPPPPAEATPPPPPP 89 >07_03_0560 + 19479597-19480667 Length = 356 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GGF G GGGGGF G G G Sbjct: 71 GGFGGGGGGGLGGGGGFGGGGGAGGG 96 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GG G GGGGGF GGG G Sbjct: 158 GGSGTGGGLGGGGGGGFGGDGGGGLG 183 >07_03_0558 + 19461369-19462448 Length = 359 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GG G GGGGGF GGG G Sbjct: 85 GGLGGGASGGVGGGGGFGGGGGGGLG 110 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GG G GGGGGF GGG G Sbjct: 159 GGVGGGAGGGVGGGGGFGGGGGGGLG 184 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GGF G GGGGGF GGG G Sbjct: 44 GGFGEGEGF--GGGGGFGGGGGGGLG 67 >07_03_0177 - 14770777-14772045 Length = 422 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GGF G GGGGG GGG G Sbjct: 77 GGFGGGGGFGGGGGGGLGGGGGGGLG 102 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GG G GGGGGF GGG G Sbjct: 69 GGGGGGGGGGFGGGGGFGGGGGGGLG 94 >06_02_0046 + 10928708-10928798,10929997-10930077,10930567-10930685, 10931275-10931894,10931992-10933184,10933280-10933359, 10933751-10933846,10933931-10934004,10936007-10936151, 10936323-10936487 Length = 887 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 494 PPPPPEDEWIPPPPPENEPAPPPPP 518 >06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700, 3363820-3364098,3364189-3364386,3364475-3365110, 3365209-3365463,3365579-3365685,3365770-3369566, 3369677-3370166,3370918-3371308,3371481-3371573, 3371687-3371810,3372544-3372791 Length = 2380 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPPXKXXXP 383 G PPP G PPPPP P Sbjct: 2 GAAPPPPGTGAPPPPPPAAVGPP 24 >03_02_0765 + 11000724-11002496 Length = 590 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GGF G GGGGG GGG G Sbjct: 114 GGFGGGKGGGLGGGGGLGGGAGGGGG 139 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GGF G GGGGG GGG G Sbjct: 476 GGFGGGAGAGTGGGGGLGGGAGGGGG 501 >01_02_0031 + 10364487-10365407 Length = 306 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 170 PPPPPPPALPAPPPPPAPMLPLAPPP 195 >01_01_0570 - 4231100-4232560 Length = 486 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GG G GGGGGF GGG G Sbjct: 140 GGLRGGGGVGAGGGGGFGGGAGGGGG 165 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 511 PPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 PP P G G P PPP PPPPP PP Sbjct: 62 PPPPHQPQFNFGP--GPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPP 107 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 4/30 (13%) Frame = -2 Query: 445 PXPPPXXG----XXPPPPPXKXXXPXXXPP 368 P PPP G PPPPP P PP Sbjct: 93 PPPPPPYGVNSSQPPPPPPPPPSPPPSAPP 122 >06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-388276, 388355-388482,388914-389048,389122-389250,389620-389787, 389897-390019,390099-390227,390543-390866,390946-392901 Length = 1448 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 48 PPPPPQPHTAPPPPPPNAEPEAPPPP 73 >01_05_0433 - 22094784-22095659 Length = 291 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 404 GGGGXXXXXGGGXXXPPPXXPXFXP 478 GGGG GGG PPP P P Sbjct: 28 GGGGVGGGGGGGAARPPPMVPGRVP 52 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -2 Query: 478 GXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXP 371 G G GG PPP PPPP P P Sbjct: 30 GGVGGGGGGGAARPPPMVPGRVPPPPMYRPKPMQAP 65 >12_02_1174 - 26696869-26698191 Length = 440 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 179 PQPPPSLQPPSPPPPPPTRPPSVKPP 204 >09_06_0283 + 22024779-22026134,22026181-22026714 Length = 629 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 366 PGGFXXGXXXFXGGGGGFXPXXGGGXG 446 P GF G GGGGG GGG G Sbjct: 21 PAGFLGGGGGGGGGGGGGGGGGGGGGG 47 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 456 GGGXXXPPPXXXKXPPPPRXKXXPPXXXPRGXP 358 G G PPP K PPP PP P G P Sbjct: 135 GPGQEPPPPHVPKAAPPP--PPPPPPHAPPGPP 165 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 1162 PSPPP--ATPPPPPPLSPSLPPPPPP 1185 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 1169 PPPPPPLSPSLPPPPPPPPLPSGPPP 1194 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPP P P PP Sbjct: 1182 PPPPPPLPSGPPPQPAPPPLPIQPPP 1207 >07_03_1636 + 28290642-28291574 Length = 310 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PP PPPPP P PP Sbjct: 182 PPSPPPAKLSPPPPPQTQTQPLAKPP 207 >07_01_0479 + 3606663-3607448 Length = 261 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = -2 Query: 517 KXPPXPXXXXXXXGXKXGXXXGGXPX-PPPXXGXXPPPPPXKXXXPXXXPP 368 + PP G G G P PPP PPPP P PP Sbjct: 210 RGPPPMGPPQVRPGMPGGPPPGMRPGMPPPPFRPGMPPPPPGPQQPGQNPP 260 >04_01_0197 + 2323790-2324098,2324145-2324774 Length = 312 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPP 401 G P PPP PPPPP Sbjct: 25 GNPPPPPPPPPPPPPPP 41 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP P P P K P PP Sbjct: 171 PPPPPPPAPEPEPEPPKKEEPQPPPP 196 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 4 PPPPPQWAMGPPPPPQYFQAGPPPPP 29 >03_01_0515 - 3864796-3865425 Length = 209 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXP 383 P PPP PPPPP P Sbjct: 89 PPPPPPPAASPPPPPPSPPPP 109 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPGXS 359 P PPP PPPPP P PP S Sbjct: 73 PPPPPSVTSSPPPPPL---PPPPPPPAAS 98 >02_05_0142 - 26227792-26228346,26228486-26228608,26229824-26230084, 26230658-26231116 Length = 465 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPP 401 G PPP G PPPPP Sbjct: 16 GKKRPPPHEGPAPPPPP 32 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PP PPPPP P PP Sbjct: 125 PQPPRAWDPSPPPPPPAPAAPVLVPP 150 >01_07_0081 - 40959279-40959375,40959463-40959589,40960138-40960339, 40962414-40963361 Length = 457 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P P P PPPPP P PP Sbjct: 13 PNPNPVSDDPPPPPPVTETKPEPEPP 38 >01_03_0270 + 14445240-14445464,14445490-14445655,14446193-14446341, 14446634-14446674,14447683-14447755 Length = 217 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXP 383 P PPP G PPPP + P Sbjct: 13 PSPPPSCGGIPPPPSRRPRPP 33 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 28.7 bits (61), Expect = 6.6 Identities = 26/108 (24%), Positives = 28/108 (25%) Frame = +1 Query: 208 PPPXXGGGPPXXFXXPPGXXPXXXXGGXFFXXPXFXXXPXXXXXPXXXNXGXPPGXXXGG 387 PPP P PP P GG + P + G Sbjct: 56 PPPPPPVVTPTPQCPPPPSYPSGGGGGGGGGTVMYTSPPPPYSGGGGGSSTGGGGIYYPP 115 Query: 388 XXFXXGGGGXFXXXXGGXXXXPPXXPXXXPPXXXXPXXXLXXXXPPPP 531 GGGG GG P P PP P PPPP Sbjct: 116 PTGGGGGGGGGWQQGGGGGGAYPTPP---PPNPFLPYFPFYYYSPPPP 160 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 396 FXGGGGGFXPXXGGGXGXPPXXXPXFXPXXXXXXXGFGGXXPXPPXKN 539 + GGGGG GG PP G GG P PP N Sbjct: 97 YSGGGGGSSTGGGGIYYPPPTGGGGGGGGGWQQGGGGGGAYPTPPPPN 144 >01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536, 7878507-7878761 Length = 223 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -1 Query: 530 GGGGXXXXKXXXGXXXXGGKXXGXXGGXXXXPPXXXXKXPPPPXKXXXPPXKXPG 366 GGGG K G GG G G PP P PP P PG Sbjct: 3 GGGGDEREKAKGGGGGGGGGGGGGEYGTFQGPP--SYPPPRPPVVGYPQPAPPPG 55 >11_01_0359 - 2731522-2732346 Length = 274 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 42 PAPPPHSHSHPPPPPPHAYHHHHYPP 67 >09_06_0172 + 21329904-21331512,21331595-21331740,21332333-21332556, 21333689-21334448 Length = 912 Score = 28.3 bits (60), Expect = 8.7 Identities = 22/77 (28%), Positives = 24/77 (31%) Frame = +1 Query: 208 PPPXXGGGPPXXFXXPPGXXPXXXXGGXFFXXPXFXXXPXXXXXPXXXNXGXPPGXXXGG 387 PPP G PP P P G + P P N G PG G Sbjct: 161 PPPQMGPPPPYGSGYAP--PPPYGSGYGYGYGPA----PDYGGGMAVANGGYDPGYGGMG 214 Query: 388 XXFXXGGGGXFXXXXGG 438 GGGG + GG Sbjct: 215 GASGGGGGGGYAPGYGG 231 >09_03_0145 - 12749288-12751510 Length = 740 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 30 PPPPPPPPGIQPPPPALPGMPHGRPP 55 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP G PPPP PP Sbjct: 31 PPPPPPPGIQPPPPALPGMPHGRPPP 56 >08_01_0059 - 394001-394708 Length = 235 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXP 370 PPP + PPPP PP P Sbjct: 3 PPPPPRRAPPPPATPPPPPRRAP 25 >07_01_0516 - 3850252-3852870 Length = 872 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 17 PQPPPTSRPLPPPPPPPPPAHGPSPP 42 >06_03_0425 - 20659298-20659634,20659964-20660075,20660161-20660272 Length = 186 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 375 FXXGXXXFXGGGGGFXPXXGGGXGXPPXXXPXF 473 F G + GGGGG GGG G P F Sbjct: 38 FGGGGGGYGGGGGGGYGGGGGGGGYSPSPTTGF 70 >03_05_0843 + 28126480-28127007,28127092-28127457,28129388-28129487, 28130266-28130546,28130643-28130705,28131276-28131431, 28131913-28132080,28132158-28132298,28132714-28132840, 28132888-28132994,28134142-28134372,28134446-28134559, 28135091-28135261 Length = 850 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 456 GGGXXXPPPXXXKXPPPPRXKXXPP 382 G PPP PPPPR PP Sbjct: 32 GAPAVMPPPPPPLPPPPPRSNSAPP 56 >03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468, 5935582-5935616,5935694-5935769,5936552-5936662, 5937001-5937087,5937302-5937395,5937489-5937606, 5938047-5938542,5939263-5939298,5940047-5940578, 5940668-5940792 Length = 703 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXP 370 PPP PPPP+ PP P Sbjct: 545 PPPPRNMLPPPPKSMPPPPPKFP 567 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXP 383 P PPP PPPPP + P Sbjct: 42 PPPPPPPPPPPPPPPLEVVSP 62 >02_04_0021 + 18975992-18976408 Length = 138 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP PP P P Sbjct: 98 PPPKPKPTPPPPAPTPKPPAPSPSPPP 124 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,155,149 Number of Sequences: 37544 Number of extensions: 398794 Number of successful extensions: 6738 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 1440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4649 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2518669100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -