BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J22 (893 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 38 0.014 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 36 0.044 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.077 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 35 0.077 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.077 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 33 0.24 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 33 0.31 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.41 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.41 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 32 0.54 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 32 0.54 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 32 0.72 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 32 0.72 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 32 0.72 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 31 0.95 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 31 1.3 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 31 1.7 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 30 2.9 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 30 2.9 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 29 3.8 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 29 5.1 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 29 5.1 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 5.1 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 29 6.7 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 529 GGXGKXPPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 GG PP P GG P PPP PPPPP P PP Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPP---PPPPPGDGGAPPPPPP 336 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPG 365 P PPP G PPPPP P PPG Sbjct: 304 PPPPPPPGGAPPPPP----PPPPPPPG 326 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 37.5 bits (83), Expect = 0.014 Identities = 29/107 (27%), Positives = 31/107 (28%) Frame = -2 Query: 526 GXGKXPPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPPGXSXNFX 347 G G PP P G GG P PP PPPP PPG Sbjct: 509 GQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQG-- 566 Query: 346 XXXXXXPXXXXXKXGPXKXXPXXXFXXXXXGGXXKXXGXPPPXXGGG 206 P + GP P G + G PPP G G Sbjct: 567 ---GGPPPPGAGQGGP--PPPGAGQEGPPPPGAGQGGGPPPPGAGQG 608 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -2 Query: 529 GGXGKXPPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPPG 365 GG G P P G GG P PP PPP PPG Sbjct: 486 GGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPG 540 Score = 29.5 bits (63), Expect = 3.8 Identities = 32/115 (27%), Positives = 33/115 (28%), Gaps = 7/115 (6%) Frame = +1 Query: 208 PPPXXG--GGPPXXFXXPPGXXPXXXXGGXFFXXPXFXXXPXXXXXPXXXNXG--XPPGX 375 PPP G GGPP G P G + P P G PPG Sbjct: 493 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGA 552 Query: 376 XXGGXXFXXG---GGGXFXXXXGGXXXXPPXXPXXXPPXXXXPXXXLXXXXPPPP 531 G G GGG G PP PP P PPPP Sbjct: 553 GQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPP----PPGAGQGGGPPPP 603 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 35.9 bits (79), Expect = 0.044 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 GG P PPP G PPPPP PP Sbjct: 650 GGIPPPPPGGGMFPPPPPPPPGGGVPGPP 678 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 439 PPPXXGXXPPPPPXKXXXPXXXPP 368 P P G PPPPP P PP Sbjct: 645 PNPFFGGIPPPPPGGGMFPPPPPP 668 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 529 GGXGKXPPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXP 383 GG PP P G G P PPP G PPPPP P Sbjct: 949 GGNAPPPPPPPG-----GSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -2 Query: 529 GGXGKXPPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPPGXS 359 GG PP P GG PPP PPP P PPG S Sbjct: 927 GGNAPLPPPPPGGS---APSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGS 980 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = -2 Query: 445 PXPPPXXGXXP-PPPPXKXXXPXXXPP 368 P PPP G P PPPP P PP Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPP 947 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = -2 Query: 454 GGXPXPPPXXGXX---PPPPPXKXXXPXXXPPG 365 G P PPP G PPPPP PPG Sbjct: 917 GSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPG 949 Score = 29.5 bits (63), Expect = 3.8 Identities = 25/94 (26%), Positives = 25/94 (26%), Gaps = 4/94 (4%) Frame = +1 Query: 211 PPXXGGGPPXXFXXPPGXX---PXXXXGGXFFXXPXFXXXPXXXXXPXXXNXGXPPGXXX 381 P GG PPG P GG P P PP Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Query: 382 GGXXFXXGGGGX-FXXXXGGXXXXPPXXPXXXPP 480 GG GGG GG PP P PP Sbjct: 960 GGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G PPP G P PPP P PP Sbjct: 960 GGSAPPPGGGAPPLPPPPGGSAPPPPPP 987 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -1 Query: 479 GGKXXGXXGGXXXXPPXXXXKXPPPPXKXXXPP 381 GG GG PP PPPP PP Sbjct: 960 GGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 35.1 bits (77), Expect = 0.077 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G P PPP G PPPPP + PP Sbjct: 303 GAPPPPPSRGSAPPPPPARMGTAPPPPP 330 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXP 383 P PPP G PPPPP + P Sbjct: 366 PPPPPVGGPPPPPPPIEGRPP 386 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = -2 Query: 520 GKXPPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G PP P G P PP G PPPPP PP Sbjct: 294 GAAPPPPSRGAPPPPPSRG---SAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -2 Query: 445 PXPPPXXGXXPPPPP 401 P PPP G PPPPP Sbjct: 365 PPPPPPVGGPPPPPP 379 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 439 PPPXXGXXPPPPPXKXXXPXXXPP 368 PPP G PPPPP PP Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPP 378 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/75 (24%), Positives = 21/75 (28%) Frame = -1 Query: 437 PPXXXXKXPPPPXKXXXPPXKXPGGXPKFXXXGXXXXXGXXXKXGXXKKXPPXXFXGKXP 258 PP + PPPP + PP P G PP G+ P Sbjct: 330 PPSRSSQRPPPPSRGAPPPPSMGMAPP---PVGGAAPPPPPPPPVGGPPPPPPPIEGRPP 386 Query: 257 GGXXKXXGGPPPXXG 213 PPP G Sbjct: 387 SSLGNPPPPPPPGRG 401 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -2 Query: 529 GGXGKXPPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 GG G PP P P PPP PPPPP P PP Sbjct: 340 GGGGVNPPPPPTNNPP---SPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G P PPP PPPPP P PP Sbjct: 383 GPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPPXKXXXPXXXP 371 G P PPP G PPPPP P P Sbjct: 383 GPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPPXKXXXP 383 G P PPP PPPPP P Sbjct: 393 GPPPPPPPTNGPPPPPPPTNGPP 415 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = -2 Query: 466 GXXXGGXPXPPPXXGXXPP-PPPXKXXXPXXXPP 368 G GG PPP PP PPP P PP Sbjct: 337 GTSGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPP 370 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP PP P P Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGP 384 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXPXIXXXXXXXXPGXXXKXGXPKKXXP 283 PP PPPP K PP G P P G P P Sbjct: 359 PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -3 Query: 456 GGGXXXPPPXXXKXPPPPRXKXXPPXXXPRGXP 358 GG PPP PPP PP P P Sbjct: 342 GGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKP 374 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = -2 Query: 466 GXXXGGXPXPPPXX----GXXPPPPPXKXXXPXXXPPG 365 G GG P PPP PPPPP P PPG Sbjct: 669 GGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPG 706 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 478 GXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G G P PPP PPPPP P PP Sbjct: 455 GDTEGVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 456 GGGXXXPPPXXXKXPPPPRXKXXPPXXXPRGXP 358 G G PPP PPPP PP P P Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P P Sbjct: 471 PPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPPXKXXXPXXXPPG 365 G P PPP PP PP P PPG Sbjct: 1251 GLPPPPPGMRPMPPQPPFMPPPPRMQPPG 1279 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP + P PP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPGXS 359 P PPP PPPPP PP S Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPS 712 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPG 365 P PPP PPPPP PG Sbjct: 697 PPPPPQPSTPPPPPPSTPPVQQSGAPG 723 Score = 28.3 bits (60), Expect = 8.9 Identities = 19/74 (25%), Positives = 23/74 (31%), Gaps = 3/74 (4%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXPXIXXXXXXXXPG---XXXKXGXPKKXXPXXXXG 268 PPP PPPP + P P P + P G P++ P G Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPP--PPG 745 Query: 267 XXPXGXXKXXGGXP 226 P GG P Sbjct: 746 QLPGQQPGQAGGRP 759 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXP 383 P PPP PPPPP P Sbjct: 233 PPPPPAAAPPPPPPPPPVKKP 253 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 GG PPP G PPPP P PP Sbjct: 118 GGYVPPPPPTGTLPPPPVTPPPGPETPPP 146 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -2 Query: 526 GXGKXPPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G PP P P PPP PPPPP P PP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 403 PPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 404 PPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP+ PP P P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PP PPPPP P PP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P P P PPPPP P PP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PP PPPPP P PP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPP P P PP Sbjct: 406 PPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PP PP P PP Sbjct: 407 PPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP PP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPP 391 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP PP P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPP 421 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -2 Query: 511 PPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPPG 365 PP P G G P PP PPPP + P PPG Sbjct: 174 PPPPSGNKPTFGNSR-TSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPG 221 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -2 Query: 439 PPPXXGXXPPPPPXKXXXPXXXPP 368 PPP PPPPP + P PP Sbjct: 311 PPPLNATPPPPPPSRDQVPLPPPP 334 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 465 GXXGGGXXXPPPXXXKXPPPPRXKXXPPXXXPRGXP 358 G GG PPP PPP R PP RG P Sbjct: 256 GPTSGGE--PPPPKNAPPPPKRGSSNPPPPPTRGPP 289 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP G PPPPP P PP Sbjct: 2 PPPPPPPG--PPPPPSAPSGPVKPPP 25 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 308 PAPPPPLNATPPPPPPSRDQVPLPPP 333 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -2 Query: 511 PPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPPG 365 PP P G G P PP PPPP + P PPG Sbjct: 86 PPPPSGNKPTFGNSR-TSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPG 133 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -2 Query: 439 PPPXXGXXPPPPPXKXXXPXXXPP 368 PPP PPPPP + P PP Sbjct: 223 PPPLNATPPPPPPSRDQVPLPPPP 246 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 465 GXXGGGXXXPPPXXXKXPPPPRXKXXPPXXXPRGXP 358 G GG PPP PPP R PP RG P Sbjct: 168 GPTSGGE--PPPPKNAPPPPKRGSSNPPPPPTRGPP 201 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 220 PAPPPPLNATPPPPPPSRDQVPLPPP 245 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GGF G GGGGGF GGG G Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGGFG 110 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GGF G GGGGG GGG G Sbjct: 99 GGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GG G GGGGGF GGG G Sbjct: 103 GGGGGGFGGGGGGGGGFGGGGGGGFG 128 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPG 365 P PP G PPPPP + P P G Sbjct: 197 PPPPGPGGIPPPPPPIRGGVPPPPPMG 223 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP G PPPPP PP Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPP 401 G P PPP G PPPPP Sbjct: 204 GIPPPPPPIRGGVPPPPP 221 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPPXKXXXPXXXPPG 365 GG P PPP PPPP + P PPG Sbjct: 193 GGPPPPPPPPPPPPPPPILELAAP--PPPG 220 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = -2 Query: 520 GKXPPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXP 383 G PP P PPP G PPPPP P Sbjct: 162 GGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 3/21 (14%) Frame = -2 Query: 454 GGXPXPP---PXXGXXPPPPP 401 GG P PP P G PPPPP Sbjct: 149 GGPPPPPPIAPATGGPPPPPP 169 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G P PPP PPPPP + PP Sbjct: 298 GFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = -2 Query: 511 PPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 PP P G P PP PPPP P PP Sbjct: 281 PPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.9 bits (64), Expect = 2.9 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 2/69 (2%) Frame = -1 Query: 413 PPPPXKXXXPPXKXPG--GXPKFXXXGXXXXXGXXXKXGXXKKXPPXXFXGKXPGGXXKX 240 PPPP + PP PG G P F G G G P F G P G Sbjct: 31 PPPPYEAPPPPPGPPGPDGPPGF--PGPQGPNGPKGPPGLPGPPGPPGFQG--PPGNPAG 86 Query: 239 XGGPPPXXG 213 GPP G Sbjct: 87 AIGPPGLPG 95 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 366 PGGFXXGXXXFX--GGGGGFXPXXGGGXGXP 452 PGGF G + GGGGG GGG G P Sbjct: 225 PGGFGGGGGVWGNGGGGGGGGGYSGGGSGNP 255 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 466 GXXXGGXPXPPPXXGXXPPPPP 401 G G P PPP PPPPP Sbjct: 164 GGGEGPNPSPPPSGAPPPPPPP 185 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPGXS 359 P P P PPPPP P PP S Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPPASS 888 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/49 (30%), Positives = 15/49 (30%), Gaps = 1/49 (2%) Frame = -2 Query: 511 PPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPP-PPPXKXXXPXXXPP 368 PP P P PPP PP PPP P PP Sbjct: 188 PPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP PP P P Sbjct: 180 PPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 165 PNPPPPNAPYPPPPYPPPPNPPYPPP 190 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPP 118 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP PP P P Sbjct: 109 PPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP PP P P Sbjct: 188 PPPPNPPYPPPPNAPNPPPPNPPYPPP 214 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P P P PPPPP P PP Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPP 230 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PP PPPPP P PP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPP 231 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPR 367 PPP P PPR PP PR Sbjct: 216 PPPPPPPSPSPPRPPPPPPPSPPR 239 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -2 Query: 517 KXPPXPXXXXXXXGXKXGXXXGGXPXPPP-XXGXXPPPPPXKXXXPXXXPPG 365 K PP P G P PPP G P PPP P PPG Sbjct: 675 KVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPP-----PPPPPPG 721 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 716 PPPPPGCAGLPPPPPSPQPGCAGLPP 741 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PP PP + P PP Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPPPPP 580 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -3 Query: 453 GGXXXPPPXXXKXPPPPRXKXXPP 382 GG PPP PPPP PP Sbjct: 208 GGAPPPPPPPFGAPPPPALNGGPP 231 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/71 (25%), Positives = 21/71 (29%) Frame = -1 Query: 434 PXXXXKXPPPPXKXXXPPXKXPGGXPKFXXXGXXXXXGXXXKXGXXKKXPPXXFXGKXPG 255 P + PPPP P + P G P+ G PP P Sbjct: 421 PAANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPR 480 Query: 254 GXXKXXGGPPP 222 G GPPP Sbjct: 481 GFPPPPFGPPP 491 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPP 382 PPP + PPPPR PP Sbjct: 489 PPPPFYRGPPPPRGMPPPP 507 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 26.6 bits (56), Expect(2) = 6.0 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 Query: 445 PXPPPXXGXXPPPPP 401 P PPP PPPPP Sbjct: 105 PPPPPPPPPPPPPPP 119 Score = 20.6 bits (41), Expect(2) = 6.0 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = -2 Query: 415 PPPPPXKXXXPXXXP 371 PPPPP P P Sbjct: 138 PPPPPPPPPAPCMPP 152 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 85 PPPPPPLPAPPPPPAQPAPQPPPAPP 110 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G P P G PPPPP P PP Sbjct: 214 GPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPP P P PP Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPP 974 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXP 383 P PPP PPPPP P Sbjct: 1163 PPPPPPSSPSPPPPPPPPPPP 1183 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = -2 Query: 511 PPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPP 401 PP P G P PPP P PPP Sbjct: 281 PPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPP 317 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,801,924 Number of Sequences: 59808 Number of extensions: 223580 Number of successful extensions: 2939 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1670 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2562198215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -