BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J22 (893 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 42 7e-04 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 34 0.15 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 33 0.26 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 33 0.26 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 33 0.34 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 32 0.45 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 31 0.78 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 31 0.78 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 31 1.0 At4g18570.1 68417.m02749 proline-rich family protein common fami... 31 1.4 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 30 1.8 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 30 1.8 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 30 2.4 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 30 2.4 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 30 2.4 At1g61080.1 68414.m06877 proline-rich family protein 30 2.4 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 29 3.1 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 29 3.1 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 29 3.1 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 29 3.1 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 29 3.1 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 29 3.1 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 29 3.1 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 29 4.2 At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-conta... 29 4.2 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 29 4.2 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 29 4.2 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 29 4.2 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 29 4.2 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 29 4.2 At5g38560.1 68418.m04662 protein kinase family protein contains ... 29 5.5 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 29 5.5 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 29 5.5 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 29 5.5 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 28 7.3 At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain... 28 7.3 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 28 7.3 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 28 7.3 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 28 7.3 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 28 7.3 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 28 7.3 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 28 7.3 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 28 7.3 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 28 7.3 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 28 7.3 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 28 7.3 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 28 9.6 At4g21720.1 68417.m03145 expressed protein 28 9.6 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 28 9.6 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 28 9.6 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 28 9.6 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 28 9.6 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 28 9.6 At1g15830.1 68414.m01900 expressed protein 28 9.6 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 28 9.6 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 28 9.6 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPPXKXXXPXXXPPG 365 GG P PPP G PPPPP P PPG Sbjct: 677 GGPPPPPPPPGGGPPPPPGGGPPPPPPPPG 706 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 211 PPXXGGGPPXXFXXPPGXXPXXXXGG 288 PP GGGPP PPG P GG Sbjct: 672 PPLPGGGPPPP-PPPPGGGPPPPPGG 696 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 436 PPXXGXXPPPPPXKXXXPXXXPPG 365 PP G PPPPP PPG Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPG 695 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -1 Query: 455 GGXXXXPPXXXXKXPPPPXKXXXPPXKXPGG 363 GG PP PPPP PP P G Sbjct: 676 GGGPPPPPPPPGGGPPPPPGGGPPPPPPPPG 706 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 33.9 bits (74), Expect = 0.15 Identities = 26/85 (30%), Positives = 27/85 (31%), Gaps = 3/85 (3%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPPXKXXXPXXXPPGXSXNFXXXXXXXPXXXXXKXGPXKXXPXXX 275 GG P PP G PPPP P PP N+ P GP P Sbjct: 249 GGPPPPPHIGGSAPPPPHMGGSAP--PPPHMGQNY------GPPPPNNMGGPRHPPPYGA 300 Query: 274 FXXXXXGG---XXKXXGXPPPXXGG 209 GG G PPP GG Sbjct: 301 PPQNNMGGPRPPQNYGGTPPPNYGG 325 Score = 33.1 bits (72), Expect = 0.26 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 3/86 (3%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPPXKXXXPXXXPPGXSXNFXXXXXXXPXXXXXKXGPXKXXPXXX 275 GG PPP G PPPP PP GP Sbjct: 258 GGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGG 317 Query: 274 FXXXXXGG---XXKXXGXPPPXXGGG 206 GG G PPP GGG Sbjct: 318 TPPPNYGGAPPANNMGGAPPPNYGGG 343 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 33.1 bits (72), Expect = 0.26 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPGXS 359 P PPP PPPPP P PP S Sbjct: 458 PPPPPVYSPPPPPPPPPPPPPVYSPPPPS 486 Score = 31.9 bits (69), Expect = 0.59 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -2 Query: 511 PPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 PP P P PPP PPPPP P PP Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP 513 Score = 31.5 bits (68), Expect = 0.78 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPP 467 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPPPP 666 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 443 PPPPPVYSPPPPPPPPPPPPVYSPPP 468 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 489 PPPPPVYSPPPPPPPPPPPPVYSPPP 514 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PP PPPPP P PP Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPP 456 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P P Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSP 466 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXPXI 352 PPP PPPP PP P P + Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPV 479 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P P Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSP 482 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP PP P P Sbjct: 505 PPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 619 PPPPPCIEYSPPPPPPVVHYSSPPPP 644 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP PP P P Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPP 470 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXPXI 352 PPP PPPP PP P P + Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPV 494 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP PP P P Sbjct: 490 PPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P P Sbjct: 502 PPPPPPPVYSPPPPPVYSSPPPPPSP 527 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 33.1 bits (72), Expect = 0.26 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPGXSXNF 350 P PPP PPPPP P PP + F Sbjct: 232 PPPPPPHQAQPPPPPPSGLFPPPPPPMANNGF 263 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 32.7 bits (71), Expect = 0.34 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 385 PPPPPPSAAAPPPPPPPKKGPAAPPP 410 Score = 31.9 bits (69), Expect = 0.59 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP K PP Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPP 411 Score = 31.9 bits (69), Expect = 0.59 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 511 PPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXPPPPPXKXXXPXXXPPG 365 PP K G P PP G PPPPP PPG Sbjct: 389 PPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPG 437 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXK--XXXPXXXPPG 365 P PP PPPPP K P PPG Sbjct: 387 PPPPSAAAPPPPPPPKKGPAAPPPPPPPG 415 Score = 27.9 bits (59), Expect = 9.6 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXPXIXXXXXXXXPGXXXKXGXPK 295 PPP PPPP P P P P K G PK Sbjct: 387 PPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPK 434 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = -2 Query: 466 GXXXGGXPXPPPXXGXXPPPPPXKXXXP 383 G G P PPP PP PP P Sbjct: 415 GKKGAGPPPPPPMSKKGPPKPPGNPKGP 442 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 32.3 bits (70), Expect = 0.45 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPGXS 359 P PPP PPPPP P PP S Sbjct: 391 PPPPPPPPPPPPPPPPPYVYPSPPPPPPS 419 Score = 31.9 bits (69), Expect = 0.59 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 31.9 bits (69), Expect = 0.59 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 31.9 bits (69), Expect = 0.59 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 31.9 bits (69), Expect = 0.59 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 31.9 bits (69), Expect = 0.59 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G P PP PPPPP P PP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXPXI 352 PPP PPPP PP P P + Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYV 409 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXPXI 352 PPP PPPP PP P P + Sbjct: 396 PPPPPPPPPPPPYVYPSPPPPPPSPPPYV 424 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 402 PPPPPPYVYPSPPPPPPSPPPYVYPP 427 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP PP P P Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P P P PPPPP P PP Sbjct: 416 PPPSPPPYVYPPPPPPYVYPPPPSPP 441 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.5 bits (68), Expect = 0.78 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP G PPPP P PP Sbjct: 391 PAPPPGSGGPKPPPPPGPKGPRPPPP 416 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.5 bits (68), Expect = 0.78 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP G PPPP P PP Sbjct: 391 PAPPPGSGGPKPPPPPGPKGPRPPPP 416 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G PPP G PPPPP + P P Sbjct: 650 GMMQPPPMPGMAPPPPPEEAPPPLPEEP 677 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 314 PPPPPPLLQQPPPPPSVSKAPPPPPP 339 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 315 PPPPPLLQQPPPPPSVSKAPPPPPPP 340 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP + PPPP PP P P Sbjct: 317 PPPLLQQPPPPPSVSKAPPPPPPPPPP 343 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP K P PP Sbjct: 277 PPPPPPPKPQPPPPP-KIARPPPAPP 301 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP P PPP P PP Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPP 290 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRG 364 PPP PPPP PP P+G Sbjct: 279 PPPPPKPQPPPPPKIARPPPAPPKG 303 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = -1 Query: 437 PPXXXXKXPPPPXKXXXPPXKXP-GGXPK 354 PP PPPP K PP P G PK Sbjct: 279 PPPPPKPQPPPPPKIARPPPAPPKGAAPK 307 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G PPP PPP P P PP Sbjct: 261 GRSAPPPPPAAAPPPQPPPPPPPKPQPP 288 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPP 382 PPP K PPPP K PP Sbjct: 90 PPPPYVKPPPPPTVKPPPP 108 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPP 382 PPP K PPPP K PP Sbjct: 106 PPPPYVKPPPPPTVKPPPP 124 Score = 29.9 bits (64), Expect = 2.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPP 382 PPP K PPPP K PP Sbjct: 98 PPPPTVKPPPPPYVKPPPP 116 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXP 370 PPP K PPPP PP P Sbjct: 138 PPPPTVKPPPPPVVTPPPPTPTP 160 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPP P P PP Sbjct: 121 PPPPPTPYTPPPPTPYTPPPPTVKPP 146 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 29.9 bits (64), Expect = 2.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -2 Query: 445 PXPPPXXGXXPPPPP 401 P PPP G PPPPP Sbjct: 36 PSPPPMSGRVPPPPP 50 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP P PPP P PP Sbjct: 26 PPPPPMRRSAPSPPPMSGRVPPPPPP 51 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G P PPP PPPPP + P PP Sbjct: 19 GRVPLPPPPP---PPPPPMRRRAPLPPPP 44 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 29.9 bits (64), Expect = 2.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PP PPPPP P PP Sbjct: 12 PQPPSQNSLAPPPPPPSLPPPVPPPP 37 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 3/57 (5%) Frame = -2 Query: 445 PXPPPXXG---XXPPPPPXKXXXPXXXPPGXSXNFXXXXXXXPXXXXXKXGPXKXXP 284 P PPP PPPPP P PP N P GP P Sbjct: 539 PPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPP 595 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPP 551 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P P Sbjct: 550 PPPPPVYSPPPPPPPVHSPPPPVFSP 575 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPP 583 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSP 85 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PP PP P PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPP 89 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP P PPP P PP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPP 90 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 528 PPPPPVYSPPPPPPVHSPPPPVHSPP 553 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P P Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSP 552 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 29.5 bits (63), Expect = 3.1 Identities = 28/98 (28%), Positives = 29/98 (29%), Gaps = 2/98 (2%) Frame = -1 Query: 494 GXXXXGGKXXGXXGGXXXXPPXXXXKXPPPPXKXXXPPXKXPGGXPKFXXXG-XXXXXGX 318 G GG+ G GG P P P P PGG P F G G Sbjct: 8 GGPGRGGRGFGGRGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGG-PGFGGRGPRGPGFGP 66 Query: 317 XXKXGXXKKXPPXXFXGKXPG-GXXKXXGGPPPXXGGG 207 P G PG G GP P GGG Sbjct: 67 RGPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGGGG 104 Score = 28.3 bits (60), Expect = 7.3 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXG-GGXGXPPXXXPXFXPXXXXXXXG---FGGXXPXPP 530 GG G F G GGG P G GG G P P F P G FGG P P Sbjct: 8 GGPGRGGRGFGGRGGG--PGFGPGGPGFGPGG-PGFGPGGPGFGPGGPGFGGRGPRGP 62 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 439 PPPXXGXXPPPPPXKXXXPXXXPP 368 PPP PPPPP P PP Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPPP 92 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P P P PPPPP P PP Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPP 77 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPGXSXNFXXXXXXXPXXXXXKXGPXKXXPXXXF 272 P PPP PPP P P PP P K P P F Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLPF 119 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 454 GGXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G P PP G PPPP P PP Sbjct: 159 GQMPPQPPFAGQGGPPPPYGMRPPYPGPP 187 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -1 Query: 437 PPXXXXKXPPPPXKXXXPPXKXPGGXP 357 PP + PPPP PP PG P Sbjct: 202 PPGGMMRGPPPPHGMQGPPPSRPGMPP 228 >At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-containing protein similar to P58 protein, Bos primigenius taurus, PIR:A56534; similar to p58 (GI:1353270) {Homo sapiens}; contains Pfam PF00226: DnaJ domain; contains Pfam PF00515: TPR Domain Length = 482 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 402 GGGGGFXPXXGGGXGXPPXXXPXFXPXXXXXXXGFGG 512 GGGGG+ P GGG G F GFGG Sbjct: 444 GGGGGYNPFHGGGGGGQQYTF-HFEGGFPGGGGGFGG 479 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GG+ G + GGGGG+ GG G Sbjct: 132 GGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GG+ G + GGGGG+ GGG G Sbjct: 125 GGYSGGGGGYGGGGGGYG-GGGGGYG 149 >At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam profile PF00397: WW domain Length = 863 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PP PPPPP P PP Sbjct: 517 PPPPSESEDVPPPPPDSYSEPIPPPP 542 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/54 (25%), Positives = 16/54 (29%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPGXSXNFXXXXXXXPXXXXXKXGPXKXXP 284 P PP PPPPP P PP + + P P P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPP 92 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPPGXS 359 P PPP PPPP P PP S Sbjct: 585 PSPPPPVHSPPPPPVFSPPPPVFSPPPPS 613 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 402 GGGGGFXPXXGGGXGXPP 455 GGG G P GGG G PP Sbjct: 409 GGGSGSPPSTGGGSGSPP 426 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 366 PGGFXXGXXXFXGGGGGFXPXXGGGXGXP 452 PGG G GGG G P GGG G P Sbjct: 408 PGG-GSGSPPSTGGGSGSPPSTGGGGGSP 435 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXPXI 352 PPP PPPP PP P P + Sbjct: 48 PPPVVSSSPPPPVVSSPPPSSSPPPSPPV 76 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 28.7 bits (61), Expect = 5.5 Identities = 15/49 (30%), Positives = 16/49 (32%), Gaps = 1/49 (2%) Frame = -2 Query: 511 PPXPXXXXXXXGXKXGXXXGGXPXPPPXXGXXP-PPPPXKXXXPXXXPP 368 PP P P PPP P PPPP + P PP Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPP 1118 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPR 367 PPP + PPPP PP P+ Sbjct: 162 PPPTVTRPPPPPTITRSPPPPRPQ 185 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXP 370 PPP K PPPP PP P Sbjct: 152 PPPYVYKSPPPPPYVYSPPPPPP 174 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 70 PPPPPYVYSSPPPPPYVYNSPPPPP 94 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 80 PPPPPYVYNSPPPPPYVYSSPPPPP 104 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 90 PPPPPYVYSSPPPPPYVYKSPPPPP 114 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 100 PPPPPYVYKSPPPPPYVYSSPPPPP 124 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 110 PPPPPYVYSSPPPPPYVYKSPPPPP 134 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 120 PPPPPYVYKSPPPPPYVYSSPPPPP 144 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 130 PPPPPYVYSSPPPPPYVYSSPPPPP 154 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 140 PPPPPYVYSSPPPPPYVYKSPPPPP 164 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 160 PPPPPYVYSPPPPPPYVYQSPPPPP 184 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 170 PPPPPYVYQSPPPPPYVYSSPPPPP 194 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 180 PPPPPYVYSSPPPPPYVYKSPPPPP 204 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 190 PPPPPYVYKSPPPPPYVYSSPPPPP 214 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 200 PPPPPYVYSSPPPPPYVYKSPPPPP 224 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 210 PPPPPYVYKSPPPPPYVYSSPPPPP 234 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 220 PPPPPYVYSSPPPPPYVYKSPPPPP 244 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 230 PPPPPYVYKSPPPPPYVYSSPPPPP 254 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 240 PPPPPYVYSSPPPPPYVYKSPPPPP 264 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 250 PPPPPYVYKSPPPPPYVYSSPPPPP 274 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 260 PPPPPYVYSSPPPPPYVYKSPPPPP 284 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 270 PPPPPYVYKSPPPPPYVYSSPPPPP 294 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 280 PPPPPYVYSSPPPPPYVYSSPPPPP 304 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 290 PPPPPYVYSSPPPPPYVYSSPPPPP 314 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 300 PPPPPYVYSSPPPPPYVYKSPPPPP 324 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 310 PPPPPYVYKSPPPPPYVYTSPPPPP 334 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 320 PPPPPYVYTSPPPPPYVYKSPPPPP 344 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 28.3 bits (60), Expect = 7.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXK 395 P PPP PPPPP K Sbjct: 380 PPPPPPPPLAPPPPPQK 396 >At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 513 Score = 28.3 bits (60), Expect = 7.3 Identities = 15/57 (26%), Positives = 18/57 (31%) Frame = -1 Query: 437 PPXXXXKXPPPPXKXXXPPXKXPGGXPKFXXXGXXXXXGXXXKXGXXKKXPPXXFXG 267 PP PPPP PP + G P G K + PP + G Sbjct: 420 PPQPFTSGPPPPQYTAVPPPRQVVGLPDTSAYTQVTYTGGMGKQVYYTEAPPPQYHG 476 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 28.3 bits (60), Expect = 7.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGGXG 446 GG G F GGGGG GGG G Sbjct: 391 GGGGNGGGSFYGGGGGRGGYGGGGSG 416 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 28.3 bits (60), Expect = 7.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXP 383 P PPP PPPPP P Sbjct: 91 PPPPPIENLPPPPPPLPKFSP 111 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 366 PGGFXXGXXXFXGGGGGFXPXXGGGXGXPPXXXPXFXP 479 P G GGGGG GGG G P P P Sbjct: 113 PANNNKGQKIGGGGGGGGGGGGGGGGGPPKMVIPQLTP 150 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 366 PGGFXXGXXXFXGGGGGFXPXXGGGXGXPPXXXPXFXP 479 P G GGGGG GGG G P P P Sbjct: 113 PANNNKGQKIGGGGGGGGGGGGGGGGGPPKMVIPQLTP 150 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 436 PPXXGXXPPPPPXKXXXPXXXPPGXS 359 PP PPPPP P PP S Sbjct: 206 PPIPSAYPPPPPSSAYPPQPYPPQPS 231 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = -1 Query: 410 PPPXKXXXPPXKXPGGXPKFXXXGXXXXXGXXXKXGXXKKXPPXXFXGKXPGGXXKXXGG 231 PPP + PP G P G G PP PGG G Sbjct: 190 PPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPG 249 Query: 230 PPP 222 PP Sbjct: 250 MPP 252 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = -1 Query: 410 PPPXKXXXPPXKXPGGXPKFXXXGXXXXXGXXXKXGXXKKXPPXXFXGKXPGGXXKXXGG 231 PPP + PP G P G G PP PGG G Sbjct: 190 PPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPG 249 Query: 230 PPP 222 PP Sbjct: 250 MPP 252 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 384 GXXXFXGGGGGFXPXXGGGXGXPP 455 G + GGGGG+ GGG G P Sbjct: 571 GGADYYGGGGGYGGVPGGGYGAMP 594 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPP P PP Sbjct: 717 PPPPPLSKTPAPPPPPLSKTPVPPPP 742 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 60 PPPPPYIYKSPPPPPYVYSSPPPPP 84 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 80 PPPPPYIYKSPPPPPYVYSSPPPPP 104 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 100 PPPPPYIYKSPPPPPYVYSSPPPPP 124 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 110 PPPPPYVYSSPPPPPYVYKSPPPPP 134 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 120 PPPPPYVYKSPPPPPYVYNSPPPPP 144 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 130 PPPPPYVYNSPPPPPYVYKSPPPPP 154 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 140 PPPPPYVYKSPPPPPYVYSSPPPPP 164 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 150 PPPPPYVYSSPPPPPYVYKSPPPPP 174 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 160 PPPPPYVYKSPPPPPYVYSSPPPPP 184 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 170 PPPPPYVYSSPPPPPYVYKSPPPPP 194 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 180 PPPPPYVYKSPPPPPYVYSSPPPPP 204 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 190 PPPPPYVYSSPPPPPYVYKSPPPPP 214 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 200 PPPPPYVYKSPPPPPYVYSSPPPPP 224 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 210 PPPPPYVYSSPPPPPYVYKSPPPPP 234 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 220 PPPPPYVYKSPPPPPYVYSSPPPPP 244 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 230 PPPPPYVYSSPPPPPYVYKSPPPPP 254 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 240 PPPPPYVYKSPPPPPYVYSSPPPPP 264 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 250 PPPPPYVYSSPPPPPYVYKSPPPPP 274 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 260 PPPPPYVYKSPPPPPYVYSSPPPPP 284 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 270 PPPPPYVYSSPPPPPYVYKSPPPPP 294 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 280 PPPPPYVYKSPPPPPYVYSSPPPPP 304 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 290 PPPPPYVYSSPPPPPYVYKSPPPPP 314 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 300 PPPPPYVYKSPPPPPYVYSSPPPPP 324 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 310 PPPPPYVYSSPPPPPYVYKSPPPPP 334 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 320 PPPPPYVYKSPPPPPYVYNSPPPPP 344 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 330 PPPPPYVYNSPPPPPYVYKSPPPPP 354 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 340 PPPPPYVYKSPPPPPYVYSSPPPSP 364 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 370 PPPPPYVYSSPPPPPYVYKSPPPPP 394 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 380 PPPPPYVYKSPPPPPYVYSSPPPPP 404 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 390 PPPPPYVYSSPPPPPYVYKSPPPPP 414 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 400 PPPPPYVYKSPPPPPYVYSSPPPPP 424 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 410 PPPPPYVYSSPPPPPYVYKSPPPPP 434 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 420 PPPPPYVYKSPPPPPYVYSSPPPPP 444 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 430 PPPPPYVYSSPPPPPYVYKSPSPPP 454 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPPP 74 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 70 PPPPPYVYSSPPPPPYIYKSPPPPP 94 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXP 371 P PPP PPPPP P P Sbjct: 90 PPPPPYVYSSPPPPPYIYKSPPPPP 114 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP P PP Sbjct: 23 PVPPPPSHISPPPPPFS--PPHHPPP 46 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -2 Query: 439 PPPXXGXXPPPPPXKXXXPXXXP 371 PPP PPPPP + P P Sbjct: 108 PPPPPKPQPPPPPPRSQKPMQPP 130 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 791 PPPPPAVHYSPPPPPVIHHSQPPPPP 816 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P P P PPPPP P PP Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPPPP 80 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 445 PXPPPXXGXXPPPPPXKXXXPXXXPP 368 P PPP PPPPP PP Sbjct: 65 PPPPPYVYNSPPPPPPYIYNSPPRPP 90 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXPXI 352 PPP K PPPP PP P + Sbjct: 37 PPPYEYKSPPPPVKSPPPPYEYKSPPPPV 65 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGG 440 GG G + GGGGG+ GGG Sbjct: 105 GGRREGGGGYSGGGGGYSSRGGGG 128 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 369 GGFXXGXXXFXGGGGGFXPXXGGG 440 GG G + GGGGG+ GGG Sbjct: 122 GGRREGGGGYSGGGGGYSSRGGGG 145 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 27.9 bits (59), Expect = 9.6 Identities = 27/108 (25%), Positives = 29/108 (26%) Frame = -1 Query: 530 GGGGXXXXKXXXGXXXXGGKXXGXXGGXXXXPPXXXXKXPPPPXKXXXPPXKXPGGXPKF 351 GGGG GG G PP P PP + GG P Sbjct: 160 GGGGEPVIPGAPPPKRGGGGEPVIPGA----PPPKRGGGGEPVIPGAPPPKRGGGGEPVI 215 Query: 350 XXXGXXXXXGXXXKXGXXKKXPPXXFXGKXPGGXXKXXGGPPPXXGGG 207 G G P + GG G PPP GGG Sbjct: 216 PGAPPPKRGG-----GGEPVIPGAPLPKRGGGGESVVPGAPPPKRGGG 258 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = -2 Query: 451 GXPXPPPXXGXXPPPPPXKXXXPXXXPP 368 G PPP PPPPP + P P Sbjct: 637 GMMQPPPMAEMPPPPPPGEAPPPLPEEP 664 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 438 PPPXXXKXPPPPRXKXXPPXXXPRGXP 358 PPP PPPP PP P P Sbjct: 505 PPPYVYSSPPPPYVYSSPPPPPPSPPP 531 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,567,981 Number of Sequences: 28952 Number of extensions: 230073 Number of successful extensions: 6229 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4080 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2100696768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -