BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J19 (946 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14698| Best HMM Match : E1_DerP2_DerF2 (HMM E-Value=4.1e-31) 34 0.19 SB_53949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_14698| Best HMM Match : E1_DerP2_DerF2 (HMM E-Value=4.1e-31) Length = 167 Score = 33.9 bits (74), Expect = 0.19 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = +3 Query: 204 ELXPVLTVXCATSKKGKTRRFLSTLHHNSPQLSSXXGLFGLKXGAEIPFDALYNADACTL 383 +L P C T KG +T N S+ +FG+ G ++PF L N + C Sbjct: 39 DLEPCEEEPC-TFHKGSNETCKATFVPNELVSSATIEVFGIIGGVQVPF-PLKNPNVCEN 96 Query: 384 --TSCPTEAGKTQTLDFS 431 CP AG + TLD + Sbjct: 97 HGVKCPINAGDSATLDLN 114 >SB_53949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 568 IQSVSSFTKQASHLFCSSTSGSH 500 +Q+VS+ K SHLF SS G+H Sbjct: 559 VQAVSTANKYISHLFSSSLFGTH 581 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,478,082 Number of Sequences: 59808 Number of extensions: 302595 Number of successful extensions: 676 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 673 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2764790632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -