BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J19 (946 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45380.1 68416.m04899 hypothetical protein contains Pfam prof... 30 1.9 At4g03890.1 68417.m00546 hypothetical protein contains Pfam prof... 28 7.8 >At3g45380.1 68416.m04899 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 690 Score = 30.3 bits (65), Expect = 1.9 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 2/75 (2%) Frame = -1 Query: 292 GELWCKVERNL--RVXPFFEVAQXTVNTGXNSDRVHRTRAGXHXPTEPXGDDVECSETTA 119 G ++ E++L V +V N G +D V AG PTEP DV ++TT Sbjct: 10 GPVYDSTEKSLSGEVSTSEQVTSEIENDGDAADLVPTEPAG---PTEPAARDVAANDTTK 66 Query: 118 EKCSEEQPRGESQXG 74 E E+ E + G Sbjct: 67 ESAEIEKAMEEPRDG 81 >At4g03890.1 68417.m00546 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 301 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 333 GAEIPFDALYNADACTLTSCPTE 401 G EI F+ +YN D T T PTE Sbjct: 241 GREIRFEEVYNEDVQTRTKAPTE 263 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,298,990 Number of Sequences: 28952 Number of extensions: 203722 Number of successful extensions: 575 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2266029384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -