BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J17 (898 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032631-5|CAA21573.1| 113|Caenorhabditis elegans Hypothetical ... 178 5e-45 L17337-6|AAA28221.2| 44|Caenorhabditis elegans Hypothetical pr... 32 0.64 Z82277-3|CAB05249.2| 495|Caenorhabditis elegans Hypothetical pr... 29 4.5 >AL032631-5|CAA21573.1| 113|Caenorhabditis elegans Hypothetical protein Y106G6H.3 protein. Length = 113 Score = 178 bits (433), Expect = 5e-45 Identities = 82/112 (73%), Positives = 96/112 (85%) Frame = +1 Query: 100 MVAAKKQKKXIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLRKSEI 279 M A K +K E+INSRL++VMK+G+Y LGYKQTLK+L GKAKLVIIA N PPLRKSEI Sbjct: 1 MAPAAKPQKNAENINSRLSMVMKTGQYVLGYKQTLKSLLNGKAKLVIIANNTPPLRKSEI 60 Query: 280 EYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLPEAS 435 EYYA+LAKTGVHHY+GNNIELGTACG+ +RVCTLA+TD GDSDII ++P S Sbjct: 61 EYYAMLAKTGVHHYNGNNIELGTACGRLFRVCTLAVTDAGDSDIILSVPSES 112 >L17337-6|AAA28221.2| 44|Caenorhabditis elegans Hypothetical protein ZK686.1 protein. Length = 44 Score = 31.9 bits (69), Expect = 0.64 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = +1 Query: 157 LVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKN 252 +VMK+G+Y L Y+Q LK+L AKLVI K+ Sbjct: 1 MVMKTGQYVL-YEQKLKSLLNENAKLVINTKH 31 >Z82277-3|CAB05249.2| 495|Caenorhabditis elegans Hypothetical protein LLC1.3 protein. Length = 495 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 73 GFISIYAPKMVAAKKQKKXIESINSRLALV 162 GF +I P V AKK +E+IN+R L+ Sbjct: 138 GFATIVGPNTVQAKKNDGSVETINARNILI 167 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,998,646 Number of Sequences: 27780 Number of extensions: 278885 Number of successful extensions: 635 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2276333906 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -