BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J16 (848 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC227.06 |||Rab GTPase binding |Schizosaccharomyces pombe|chr ... 42 8e-05 SPAPB1E7.05 |gde1||glycerophosphoryl diester phosphodiesterase G... 26 7.8 >SPAC227.06 |||Rab GTPase binding |Schizosaccharomyces pombe|chr 1|||Manual Length = 249 Score = 42.3 bits (95), Expect = 8e-05 Identities = 22/51 (43%), Positives = 33/51 (64%) Frame = +1 Query: 544 WTIEYYQKYFDVQTSEVVERIISSVLPQKVSRNYFDEXIKGXPDLYGPIWI 696 WTI+ F+V+T +VV+R I +++P + N+FD + PDLYGP WI Sbjct: 50 WTIK---DSFNVETKDVVQRCIHTLIP---TVNFFD-VVDDRPDLYGPFWI 93 >SPAPB1E7.05 |gde1||glycerophosphoryl diester phosphodiesterase Gde1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1076 Score = 25.8 bits (54), Expect = 7.8 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = -3 Query: 291 NEIKQILEKFTVQYWLVKMLTSYIKFQVIAKV 196 +E+K LEK ++ + L K L ++I+ + A+V Sbjct: 127 SEVKDKLEKLSIHHPLKKDLLAFIQLDIAAEV 158 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,176,074 Number of Sequences: 5004 Number of extensions: 61642 Number of successful extensions: 127 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 420459900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -