BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J16 (848 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precu... 27 0.54 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 5.1 >AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precursor protein. Length = 267 Score = 27.5 bits (58), Expect = 0.54 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +2 Query: 497 ELFQKQRLN-LSRITTSGQ*SIIRNTLMCRPVKLWRGLYHQYCPRKSLETILMRXSKANL 673 +LFQ L LS+I +G + + + +RG+ +Y +++ T+++ +KA Sbjct: 148 DLFQSSSLKELSKIDFTGFYNGTNKDTVIKLSNAFRGIVEKYARKENQATVVIDVAKAAA 207 Query: 674 ICMDLS 691 C D S Sbjct: 208 YCADPS 213 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 5.1 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 209 LLQKYKNRYCFRPRNETLQLIYALIFRY 126 +L KYK RY RP + L I+ + Y Sbjct: 1810 VLGKYKRRYAMRPEIKVLANIFPVAEGY 1837 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 797,828 Number of Sequences: 2352 Number of extensions: 15697 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90132318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -