BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J08 (923 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating tra... 28 2.1 SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces... 27 2.8 SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosacch... 26 8.6 >SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating transcription Rct1|Schizosaccharomyces pombe|chr 2|||Manual Length = 432 Score = 27.9 bits (59), Expect = 2.1 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 273 RYHSLCQFYNIHHQ--CLVGSHLG 208 +Y++ C FYNI H C G LG Sbjct: 35 KYYNFCPFYNIQHNYTCQTGDPLG 58 >SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 27.5 bits (58), Expect = 2.8 Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +3 Query: 186 QKKILSFFQDVSQLNTDDEYYKIGKDY-DIEMNMDNYTNKKAVEEFLKMYRTGFMP 350 + K+ D + L DD KD+ ++ +N +Y NK ++ F + + F P Sbjct: 617 EMKLSDKIDDANSLKDDDFIQGSKKDFFEMNLNHSSYQNKDELKPFQLLVKHAFKP 672 >SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1031 Score = 25.8 bits (54), Expect = 8.6 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +3 Query: 198 LSFF--QDVSQLNTDDEYYKIGKDYDIEMNMDN 290 L+FF Q+V Q+N +DEY + + D E +DN Sbjct: 49 LNFFSTQNVMQMNFEDEYSEFSNE-DDEAEIDN 80 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,213,579 Number of Sequences: 5004 Number of extensions: 62818 Number of successful extensions: 193 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 467341524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -