BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J07 (945 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 29 0.72 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 28 1.7 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 26 6.7 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 29.5 bits (63), Expect = 0.72 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPPAXTGXXPP----XGGNXVSPKPXGXPXKTI 614 G PPPPPP G PP PP G +P P P I Sbjct: 760 GPPPPPPPPGVAGAGPPPPP--PPPPAVSAGGSRYYAPAPQAEPEPKI 805 Score = 27.9 bits (59), Expect = 2.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXG 521 PP G G PPPPPP G Sbjct: 765 PPPPGVAGAGPPPPPPPPPAVSAG 788 Score = 26.2 bits (55), Expect = 6.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPP 506 PP G G PPPPPP Sbjct: 763 PPPPPPGVAGAGPPPPPPP 781 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 28.3 bits (60), Expect = 1.7 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 PP G PPPPPP+ P PP G + P P Sbjct: 325 PPIGNGSSNSSLPPPPPPPRSNAAGSIP------LPPQGRSAPPPPP 365 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 26.2 bits (55), Expect = 6.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPPAXTGXXPPXG 566 G PPPPPP PP+ PP G Sbjct: 7 GNPPPPPPPP---GFEPPSQPPPPPPPG 31 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,829,023 Number of Sequences: 5004 Number of extensions: 20075 Number of successful extensions: 101 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 481321826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -