BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J07 (945 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0080 + 587674-588510 40 0.002 01_06_1792 - 39912714-39913559 39 0.007 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 30 0.040 01_01_0715 - 5542648-5543219,5543352-5543544 36 0.047 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 36 0.062 03_01_0515 - 3864796-3865425 35 0.082 02_05_0686 - 30900748-30902167,30903442-30904742 35 0.11 07_03_1136 + 24218601-24218734,24218769-24219906 34 0.14 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 34 0.19 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 34 0.19 09_02_0495 + 9880714-9881196 32 0.76 09_04_0684 - 19442335-19442990,19443774-19443839,19443935-194440... 31 1.0 03_05_0067 - 20460206-20460703,20461255-20461530 31 1.0 11_01_0133 + 1121392-1122731,1123417-1123858 31 1.3 09_02_0543 + 10427321-10428315,10428440-10429154 31 1.3 09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415,243... 31 1.3 07_01_0479 + 3606663-3607448 31 1.3 12_01_0239 - 1793612-1793716,1793808-1793826,1794424-1794599,179... 31 1.8 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 30 2.3 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 30 2.3 07_03_1691 - 28726307-28726323,28726588-28726953,28727483-287275... 30 2.3 06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411... 30 2.3 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 30 2.3 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 30 2.3 01_01_0082 + 625198-625719 30 2.3 01_01_0083 + 631196-631675 30 3.1 08_02_0672 - 19904353-19904839,19905646-19905704,19906137-199063... 29 4.1 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 29 4.1 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 29 4.1 02_04_0382 - 22501041-22501279,22501717-22501810 29 4.1 01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 29 4.1 12_01_0135 + 1042889-1044255,1045368-1045809 29 5.4 11_01_0242 - 1862106-1862210,1862302-1862320,1863082-1863257,186... 29 5.4 09_02_0223 + 5977138-5977459,5979842-5980842 29 5.4 04_04_1182 + 31531426-31531702,31533741-31533997,31534672-315348... 29 5.4 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 29 5.4 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 29 5.4 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 24 6.2 07_03_1788 + 29523216-29524867,29525048-29525075 29 7.1 05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237,364... 29 7.1 02_04_0169 + 20554715-20555083,20555150-20555632,20557926-205580... 29 7.1 01_06_0565 + 30287253-30287502,30287522-30289010,30289133-302892... 29 7.1 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 29 7.1 01_03_0005 + 11568545-11569119,11569179-11569191 29 7.1 03_05_1016 + 29726949-29727503,29728863-29729504 25 8.2 08_01_0059 - 394001-394708 28 9.4 07_03_1140 - 24258627-24258849,24259967-24260089,24260200-242609... 28 9.4 07_03_0890 - 22332768-22333382 28 9.4 07_03_0758 - 21292205-21293329 28 9.4 07_01_0974 + 8211602-8212051 28 9.4 07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428... 28 9.4 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 28 9.4 04_04_0295 - 24212526-24212684,24213066-24213218,24213497-242136... 28 9.4 04_03_0977 + 21381857-21383757,21384299-21384458,21384669-213847... 28 9.4 03_03_0118 + 14597863-14597929,14598844-14599806,14599909-145999... 28 9.4 02_05_0002 - 24849189-24849825,24850267-24850328 28 9.4 02_02_0240 + 8196140-8198248,8198381-8198650 28 9.4 >07_01_0080 + 587674-588510 Length = 278 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 447 TPPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPP 560 TPP GG G PPPPPP G PP PP Sbjct: 78 TPPRLGGDGMFRRPPPPPPPPPSSGSPPPPPPPPPPPP 115 >01_06_1792 - 39912714-39913559 Length = 281 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/51 (39%), Positives = 23/51 (45%) Frame = -3 Query: 601 GXPXGLGETXFPPXGGXXPVXAGGXXXPXXFLGGGGGGXPXXKPPPPXXGG 449 G G G + P GG + +G P GGGG G P PPPP GG Sbjct: 148 GKDGGYGGSNSPYGGGSSIIISGAAPIPHNNFGGGGTGWPV--PPPPQDGG 196 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 PPPPPP PP PP N + P P Sbjct: 620 PPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPP 653 Score = 29.1 bits (62), Expect(2) = 0.040 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPPPPP PP PP + V P P P Sbjct: 604 PPPPPPPILPNRSVPPPPP-PPPPLPNHSVLPPPPPPP 640 Score = 29.1 bits (62), Expect = 5.4 Identities = 18/62 (29%), Positives = 21/62 (33%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXP 629 PP PPPPPP PP P G +P P P ++ S P Sbjct: 624 PPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPA---PGIGNKFPAPPPPPPPPRS-SSRTP 679 Query: 630 XG 635 G Sbjct: 680 TG 681 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/55 (25%), Positives = 18/55 (32%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXPXGXXPKTA 653 PPPPPP PP P V P P + P P+++ Sbjct: 621 PPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPPRSS 675 Score = 25.8 bits (54), Expect(2) = 0.040 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPP 506 PP G PPPPPP Sbjct: 551 PPPPSGNKPAFSPPPPPPP 569 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 35.9 bits (79), Expect = 0.047 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXG 596 PP G G PP P G PP PP GGN +P P G Sbjct: 163 PPAAGTNGTARAPSPPVPAPAPAGSPPPPPP----PPAGGNFTAPSPAG 207 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 G PPPPPP G P+ P G N +P P Sbjct: 186 GSPPPPPPPPAGGNFTAPS-----PAGGMNFTAPAP 216 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 35.5 bits (78), Expect = 0.062 Identities = 23/71 (32%), Positives = 24/71 (33%), Gaps = 6/71 (8%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPP------XGGNXVSPKPXGXPXKT 611 PP GG PPPP G P A G PP GG P P G P Sbjct: 1149 PPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPAPP 1208 Query: 612 IXSXXPXGXXP 644 + P G P Sbjct: 1209 MPPGVPGGPPP 1219 Score = 35.1 bits (77), Expect = 0.082 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = +3 Query: 447 TPPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 TPP GG PPPPPP+ G PP G P P P G P Sbjct: 1173 TPPPNAHGGV---APPPPPPRGHGGVGGPPTPPGAPAP-------PMPPGVP 1214 Score = 32.7 bits (71), Expect = 0.44 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXG 596 PP GG G P PP P+ G PP G GG P P G Sbjct: 1124 PPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGG----LGGPPAPPPPAG 1168 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = +3 Query: 450 PPXXGGGGXXX-----GXPPPP-PPKXXXGXXXPPAXTGXXPPXGGNXV 578 PP G GG G P PP PP G PP G P GG V Sbjct: 1187 PPPRGHGGVGGPPTPPGAPAPPMPPGVPGGPPPPPGGRGLPAPPGGRGV 1235 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXG 596 PP G G PPPPP G PPA P G P P G Sbjct: 1109 PPPPPPPGGITGVPPPPPIGGLGGHQAPPAP--PLPEGIGGVPPPPPVG 1155 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 G PPPPPP PP G GG+ P P Sbjct: 1107 GAPPPPPPPGGITGVPPPPPIGG---LGGHQAPPAP 1139 >03_01_0515 - 3864796-3865425 Length = 209 Score = 35.1 bits (77), Expect = 0.082 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXP 629 PPPPPP PP PP + P P P + S P Sbjct: 71 PPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPP 117 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPPPPPK G PP G PP SP P P Sbjct: 336 PPPPPPK---GPPPPPPAKGPPPPPPPKGPSPPPPPPP 370 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +3 Query: 447 TPPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 +PP G G PPPPPPK G PPA G KP Sbjct: 363 SPPPPPPPGGKKGGPPPPPPK--GGASRPPAAPGVPTGSADQQAKLKP 408 Score = 31.9 bits (69), Expect = 0.76 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXPXGXXPK 647 PPPPPPK PP PP P P G P P PK Sbjct: 314 PPPPPPKPAAAAPPPPPPPKAAPP------PPPPKGPPPPPPAKGPPPPPPPK 360 Score = 31.9 bits (69), Expect = 0.76 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXG 596 PPPPPP PP PP G P P G Sbjct: 326 PPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKG 361 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPPAXTG----XXPPXGGNXVSPKP 590 G PPPPP K G PP G PP GG P P Sbjct: 343 GPPPPPPAK---GPPPPPPPKGPSPPPPPPPGGKKGGPPP 379 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 7/58 (12%) Frame = -3 Query: 601 GXPXGLGETXFPPXGGXX-------PVXAGGXXXPXXFLGGGGGGXPXXKPPPPXXGG 449 G G G PP G P GG P LGGGGGG +PP GG Sbjct: 110 GGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGG 167 Score = 32.7 bits (71), Expect = 0.44 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = -3 Query: 601 GXPXGLGETXFP-PXGGXXPVXAGGXXXPXXFLGGGGGGXPXXKPPPPXXGG 449 G P G G P GG P GG P G GGG +PP P GG Sbjct: 89 GLPPGGGGAPGPLGGGGARPPGGGGGGGPPSLPPGAGGGG-GARPPAPGGGG 139 Score = 29.5 bits (63), Expect = 4.1 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Frame = -3 Query: 601 GXPXGLGETXFPPXGGXX------PVXAGGXXXPXXFLGGGGGGXPXXKPPPPXXGG 449 G G G PP GG P GG P GGGGGG + P GG Sbjct: 149 GGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGG 205 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTG 548 PP GGGG G P PP G PPA G Sbjct: 108 PPGGGGGG---GPPSLPPGAGGGGGARPPAPGG 137 Score = 28.7 bits (61), Expect = 7.1 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 601 GXPXGLGETXFPPXGGXXPVXAGGXXXPXXFLGGGGGGXPXXKPPPPXXGG 449 G G E F GG GG L GGGGG PP P GG Sbjct: 306 GGGHGAPELGFSGGGGGG---GGGEIAGTVDLRGGGGGAGGVFPPTPDLGG 353 Score = 26.2 bits (55), Expect(2) = 0.78 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 538 AGGXXXPXXFLGGGGGG 488 AGG P LGGGGGG Sbjct: 341 AGGVFPPTPDLGGGGGG 357 Score = 24.2 bits (50), Expect(2) = 0.78 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -3 Query: 505 GGGGGGXPXXKPPPPXXGG 449 GGGGGG KP GG Sbjct: 375 GGGGGGGMLDKPDEAGGGG 393 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/54 (27%), Positives = 19/54 (35%) Frame = +3 Query: 429 FFXXXXTPPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 ++ PP G PPPPPP PP PP ++P P Sbjct: 89 YYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPP 142 Score = 28.7 bits (61), Expect = 7.1 Identities = 19/65 (29%), Positives = 21/65 (32%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXP 629 P G G PPPPP+ PP PP G N P P P + P Sbjct: 68 PQFNFGPGPPQQQQPPPPPQMYYQPPPPP------PPYGVNSSQPPPPPPPPPSPPPSAP 121 Query: 630 XGXXP 644 P Sbjct: 122 PPPPP 126 Score = 25.8 bits (54), Expect(2) = 0.58 Identities = 12/38 (31%), Positives = 12/38 (31%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPPPP PP PP P P P Sbjct: 94 PPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQP 131 Score = 25.0 bits (52), Expect(2) = 0.58 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPP 506 PP G PPPPPP Sbjct: 42 PPPQGAPPPFLAPPPPPPP 60 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 453 PXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 P G G G PPPPP PPA + G P P P Sbjct: 309 PPGAGAGAGTGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAP 358 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 453 PXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXG 566 P G G PPPPPP P G PP G Sbjct: 338 PSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPG 375 >09_02_0495 + 9880714-9881196 Length = 160 Score = 31.9 bits (69), Expect = 0.76 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 462 GGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 G GG G PPPPP G PP G P G P P Sbjct: 70 GAGGLFGGTYPPPPPGVMPGAFAPPFGGGF--PYGPAPPPPNP 110 >09_04_0684 - 19442335-19442990,19443774-19443839,19443935-19444032, 19444787-19445157 Length = 396 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PP G PPPPPP G P G P G P G P Sbjct: 309 PPGYQGSNQGYQGPPPPPPSAYQGNN--PGYQGGGPGYQGGNPPPYQGGNP 357 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPP 560 PPPPPP+ G P A G PP Sbjct: 25 PPPPPPQYFQGAHPPAAMWGQPPP 48 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXK 608 PPPPPP P A PP + P P P K Sbjct: 134 PPPPPPPSHPALLPPDATAPPPPPTSVAALPPPPPPQPDK 173 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 PPPP P PPA PP G +P P Sbjct: 45 PPPPTPAPQSSPAPPPAPDMTPPPGPGPAAAPSP 78 >09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415, 2439856-2440214 Length = 398 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 453 PXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 P GG PPPPPP G P G P G P G P Sbjct: 301 PGYQGGNQEYRGPPPPPPSAYQGNN--PGYQGGGPGYHGGNPPPYQAGNP 348 >07_01_0479 + 3606663-3607448 Length = 261 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGG 569 PP G G P PPP G PP G PP G Sbjct: 212 PPPMGPPQVRPGMPGGPPPGMRPGMPPPPFRPGMPPPPPG 251 >12_01_0239 - 1793612-1793716,1793808-1793826,1794424-1794599, 1794701-1794747,1795760-1796291 Length = 292 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 453 PXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 P GGGG P P G PP+ P G S P G P Sbjct: 54 PYYGGGGGYGAPPSTQPYGSGGGYGAPPSSQPYGAPYGAPPPSSAPYGAP 103 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPP--XGGNXVSPKP 590 PPPPPP G PP G P GG+ V P Sbjct: 625 PPPPPPGKPGGPPPPPPRPGSLPRNLAGGDKVHRAP 660 Score = 28.3 bits (60), Expect = 9.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPP 536 G PPPPPP G PP Sbjct: 622 GAPPPPPPPGKPGGPPPP 639 Score = 23.8 bits (49), Expect(2) = 4.6 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPP 503 PP G G PPPPP Sbjct: 624 PPPPPPPGKPGGPPPPPP 641 Score = 23.8 bits (49), Expect(2) = 4.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +3 Query: 483 GXPPPPPPK 509 G PPPPPP+ Sbjct: 634 GGPPPPPPR 642 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPP--XGGNXVSPKP 590 PPPPPP G PP G P GG+ V P Sbjct: 930 PPPPPPGKPGGPPPPPPPPGSLPRNLAGGDKVHRAP 965 Score = 28.3 bits (60), Expect = 9.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPP 536 G PPPPPP G PP Sbjct: 927 GAPPPPPPPGKPGGPPPP 944 >07_03_1691 - 28726307-28726323,28726588-28726953,28727483-28727567, 28728255-28728387,28729793-28730328 Length = 378 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 453 PXXGGGGXXXGXPPPPPP 506 P GGGG G PPPPP Sbjct: 31 PSCGGGGGGAGPTPPPPP 48 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPP 506 P GGGG PPPPPP Sbjct: 31 PSCGGGGGGAGPTPPPPPP 49 Score = 28.7 bits (61), Expect = 7.1 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 505 GGGGGGXPXXKPPPP 461 GGGGG P PPPP Sbjct: 35 GGGGGAGPTPPPPPP 49 Score = 28.3 bits (60), Expect = 9.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -3 Query: 520 PXXFLGGGGGGXPXXKPPPP 461 P GGGGGG PPPP Sbjct: 29 PIPSCGGGGGGAGPTPPPPP 48 Score = 28.3 bits (60), Expect = 9.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 462 GGGGXXXGXPPPPPP 506 GGGG PPPPPP Sbjct: 36 GGGGAGPTPPPPPPP 50 >06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104, 25541673-25541751,25542151-25542238,25542330-25542600, 25542676-25542718,25542801-25542904,25543374-25543790 Length = 2068 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPPPPP PP G P + SP P P Sbjct: 93 PPPPPPLPQHRLEPPPPHYGFPPRGHPDAYSPPPYHDP 130 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPPPPP PP P N PKP P Sbjct: 359 PPPPPPPKLNTAPKPPPPPPPPPSVPSNNNLPKPAEPP 396 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKT 611 PPPPPP G PP + P GG S + P T Sbjct: 83 PPPPPPPPTNGTLTPPPSSA---PSGGRATSSEARESPHAT 120 >01_01_0082 + 625198-625719 Length = 173 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPP PP P+ PP GG +P P P Sbjct: 74 PPPSPPPVAYPPPTTPSTNCPPPPYGGGGYNPTPSYNP 111 >01_01_0083 + 631196-631675 Length = 159 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 414 GXXGRFFXXXXTPPXXGGGGXXXGXPPPPPP 506 G G + P GGGG P PPPP Sbjct: 82 GGGGGYIPYYQPPAGGGGGGGGFNYPAPPPP 112 >08_02_0672 - 19904353-19904839,19905646-19905704,19906137-19906352, 19906845-19907422,19907506-19908180,19908263-19908653, 19909469-19909621,19909727-19909980,19911023-19911479 Length = 1089 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 G PPPPPP PP G P +P G P Sbjct: 82 GAPPPPPPPQQVQVQVPPQYGGVPNPGYPMAQQMQPPGVP 121 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPP 560 PPPPPP G PP PP Sbjct: 1932 PPPPPPPPVEGKPKPPPHAPPPPP 1955 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 492 PPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPPPP PPA PP G +P P P Sbjct: 446 PPPPPGSSMYNPPPPAPGQATPPPYGVQYAPPPAPIP 482 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 453 PXXGGGGXXXGXPPPPPP 506 P GGGG G PPPPPP Sbjct: 87 PYYGGGGGY-GKPPPPPP 103 >01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 Length = 301 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = -3 Query: 601 GXPXGLGETXFPPXGGXXPVXAGGXXXPXXFLGGGGGGXPXXKPPPPXXGGVXXXXKNLP 422 G P G G P GG P GG GGG P P GG + P Sbjct: 93 GGPSG-GALPSPSHGGAAPSHGGGYGASPPVTPSPGGGYGGGSPAPSHGGGAYGSSPSTP 151 >12_01_0135 + 1042889-1044255,1045368-1045809 Length = 602 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 492 PPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXK 608 PPPPP P A PP + P P P K Sbjct: 136 PPPPPPSHPALLPPDATAPPPPPTSVAALPPPPPAQPDK 174 >11_01_0242 - 1862106-1862210,1862302-1862320,1863082-1863257, 1863359-1863405,1864443-1865022 Length = 308 Score = 29.1 bits (62), Expect = 5.4 Identities = 20/65 (30%), Positives = 22/65 (33%), Gaps = 2/65 (3%) Frame = +3 Query: 414 GXXGRFFXXXXTPPXXGGGGXXXGXPPPP--PPKXXXGXXXPPAXTGXXPPXGGNXVSPK 587 G G + T P GGG G PP P G PP+ P G S Sbjct: 57 GGGGGYGAPPSTQPYGSGGG--YGAPPSTQRPQSYGGGYGAPPSSQPYGAPYGAPPPSSA 114 Query: 588 PXGXP 602 P G P Sbjct: 115 PYGAP 119 >09_02_0223 + 5977138-5977459,5979842-5980842 Length = 440 Score = 29.1 bits (62), Expect = 5.4 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGG 569 PP PPP G PP+ G P G Sbjct: 392 PPSPPPSDAEGDAPPPSGDGDEAPGSG 418 >04_04_1182 + 31531426-31531702,31533741-31533997,31534672-31534818, 31535974-31536111 Length = 272 Score = 29.1 bits (62), Expect = 5.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPP 506 P GGGG G PP PPP Sbjct: 50 PGGGGGGGGGMGIPPRPPP 68 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 P PPPPK PPA PP P+P Sbjct: 191 PQPPPPKEEEKPEPPPAVIIVEPPAPAPEPEPEP 224 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 PPPPPP PP PP P+P Sbjct: 171 PPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEP 204 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.1 bits (62), Expect = 5.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPP 560 PPPPPP PP G PP Sbjct: 364 PPPPPPPPRPPPPPPPIKKGAPPP 387 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 23.8 bits (49), Expect(2) = 6.2 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 471 GXXXGXPPPPPPK 509 G PPPPPPK Sbjct: 38 GADLSPPPPPPPK 50 Score = 23.4 bits (48), Expect(2) = 6.2 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPA 539 PPPPPP PP+ Sbjct: 43 PPPPPPPKPPPTVPPPS 59 >07_03_1788 + 29523216-29524867,29525048-29525075 Length = 559 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTG 548 PP G G PPPPPP PP+ G Sbjct: 18 PPKRGRGRPRKNPPPPPPPATDPN-PHPPSGAG 49 >05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237, 3645328-3645525,3645614-3646249,3646352-3646606, 3646718-3646824,3646909-3650705,3650816-3651305, 3652043-3652433,3652621-3652713,3652818-3652941, 3653871-3654118 Length = 2350 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSP 584 G PPPP P A PP GG ++P Sbjct: 2 GAAPPPPGTGAPPPPLPAAAAAAGPPGGGKPLTP 35 >02_04_0169 + 20554715-20555083,20555150-20555632,20557926-20558003, 20558141-20558143 Length = 310 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/49 (30%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +3 Query: 462 GGGGXXXGXPPPPPP--KXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 GG PPPPPP PPA P P+P P Sbjct: 167 GGSSSSSAPPPPPPPAAADDTAAVMPPAPAVPPPDAAAVTAGPEPAPAP 215 >01_06_0565 + 30287253-30287502,30287522-30289010,30289133-30289277, 30289679-30289729 Length = 644 Score = 28.7 bits (61), Expect = 7.1 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 9/59 (15%) Frame = +3 Query: 447 TPPXXGGGGXXXGXP---PPPP-----PKXXXGXXXPPAXT-GXXPPXGGNXVSPKPXG 596 T P GGG P PP P P G PPA T G PP + SP G Sbjct: 422 TSPTTPGGGYSPSTPCNAPPSPSSDTSPTTPGGGNYPPAPTIGNVPPSPSSGTSPSTPG 480 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/52 (30%), Positives = 19/52 (36%) Frame = +3 Query: 447 TPPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 +P GGGG P PP P + T P GG +P P P Sbjct: 165 SPTTPGGGGGYSPTPSDTPPS-------PSSDTSPTTPGGGGGYTPTPSDAP 209 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 28.7 bits (61), Expect = 7.1 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTG--XXPPXGGNXVSPKPXGXPXKTIXSXXPXGXXPK 647 P P PPK G P G PP G PKP K G PK Sbjct: 165 PKPSPPKPKPGPKPKPPKPGPKPKPPKPGPKPKPKPPKPGPKPKPKPPKPGPKPK 219 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 505 GGGGGGXPXXKPPPPXXGG 449 GGGGG PPPP GG Sbjct: 82 GGGGGTVMYTSPPPPYSGG 100 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 601 GXPXGLGETXFPPXGGXXPVXAGGXXXPXXFLGGGGGGXPXXKPPPP 461 G G G +PP G GG GGGGG P PP P Sbjct: 103 GSSTGGGGIYYPPPTGGGGGGGGGWQQG----GGGGGAYPTPPPPNP 145 >03_05_1016 + 29726949-29727503,29728863-29729504 Length = 398 Score = 25.4 bits (53), Expect(2) = 8.2 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 453 PXXGGGGXXXGXPPPPPP 506 P G G PPPPPP Sbjct: 69 PCLGAWGAAGAPPPPPPP 86 Score = 21.4 bits (43), Expect(2) = 8.2 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +3 Query: 489 PPPPPPK 509 PPPPPP+ Sbjct: 82 PPPPPPE 88 >08_01_0059 - 394001-394708 Length = 235 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPPPP + PP PP + P P P Sbjct: 3 PPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTP 40 >07_03_1140 - 24258627-24258849,24259967-24260089,24260200-24260921, 24260945-24261073,24261484-24261714 Length = 475 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 462 GGGGXXXGXPPPPPPKXXXGXXXPPA 539 GGGG PP PPP G PA Sbjct: 9 GGGGGSLWGPPQPPPSTGGGIPQLPA 34 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 505 GGGGGGXPXXKPPPPXXG 452 GGGGGG P PPPP G Sbjct: 53 GGGGGGWP--PPPPPLSG 68 >07_03_0890 - 22332768-22333382 Length = 204 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPPPPP P A PP +P P P Sbjct: 84 PPPPPPPPPPERAVPEAADTPPPPPPPTAPTPTPPELP 121 >07_03_0758 - 21292205-21293329 Length = 374 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 483 GXPP-PPPPKXXXGXXXPPAXTGXXPPXGGN 572 G PP PPPP PP+ G P GN Sbjct: 288 GLPPSPPPPGLSAPSGLPPSPPGLRPAASGN 318 >07_01_0974 + 8211602-8212051 Length = 149 Score = 28.3 bits (60), Expect = 9.4 Identities = 19/63 (30%), Positives = 22/63 (34%), Gaps = 6/63 (9%) Frame = +3 Query: 426 RFFXXXXTPPXX--GGGGXXXGXPPPP----PPKXXXGXXXPPAXTGXXPPXGGNXVSPK 587 +F+ PP GGGG G P PP PP A PP N +P Sbjct: 43 QFYYYSPPPPSSPVGGGGTGGGGPSPPTNPAPPAVPCNCGTTTAPAAPSPPGVYNYSAPS 102 Query: 588 PXG 596 G Sbjct: 103 GGG 105 >07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089, 4287286-4287350,4288346-4288451,4288529-4288750, 4289619-4289852,4289948-4290037,4290605-4291507 Length = 650 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPPP P PPA T PP P P Sbjct: 59 PPPPTPAVEPTLPIPPASTPPTPPQPSASTEPSTAPPP 96 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 28.3 bits (60), Expect = 9.4 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 601 GXPXGLGETXFPPXGGXXPVXAGGXXXPXXFLGGGGGG 488 G P G G + P GG GG GGGGGG Sbjct: 47 GPPGGGGGRGYEPGGGRGYGGGGGGGGRGYGGGGGGGG 84 >04_04_0295 - 24212526-24212684,24213066-24213218,24213497-24213601, 24213694-24213913,24214033-24214199,24214323-24214497, 24214627-24214799,24214914-24214983,24215401-24215900 Length = 573 Score = 28.3 bits (60), Expect = 9.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 505 GGGGGGXPXXKPPPPXXGGV 446 GGGGG P + P P GGV Sbjct: 10 GGGGGEQPRRRKPAPGRGGV 29 >04_03_0977 + 21381857-21383757,21384299-21384458,21384669-21384717, 21385117-21385169 Length = 720 Score = 28.3 bits (60), Expect = 9.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 462 GGGGXXXGXPPPPPPKXXXG 521 GGGG PPPPPP G Sbjct: 93 GGGGWVQLPPPPPPPPPPQG 112 >03_03_0118 + 14597863-14597929,14598844-14599806,14599909-14599936, 14600288-14600666 Length = 478 Score = 28.3 bits (60), Expect = 9.4 Identities = 22/70 (31%), Positives = 23/70 (32%) Frame = +3 Query: 447 TPPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXX 626 TPP G PP G PPA PP GG P G P S Sbjct: 379 TPPV-GTSPPTDFSPPAAGTTPPAGGFTPPAGGFGTPPLGGFGTPPSGFGPPGSFNGSGS 437 Query: 627 PXGXXPKTAF 656 G P +AF Sbjct: 438 SFG--PSSAF 445 >02_05_0002 - 24849189-24849825,24850267-24850328 Length = 232 Score = 28.3 bits (60), Expect = 9.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXG 521 P GGG PPPPPP G Sbjct: 206 PADTSGGGGHPHPPPPPPPPPSAG 229 >02_02_0240 + 8196140-8198248,8198381-8198650 Length = 792 Score = 28.3 bits (60), Expect = 9.4 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 P G G PPPPPP PP P G + P P Sbjct: 9 PAPDGDGDSHPQQPPPPPPGGGAKPEPPPTVATHTRPLG--IIHPPP 53 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,578,587 Number of Sequences: 37544 Number of extensions: 396932 Number of successful extensions: 5187 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 2038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4299 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2717819680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -