BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J07 (945 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 43 4e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 37 0.027 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 33 0.34 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 33 0.44 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 32 0.78 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.78 SB_4337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.78 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 31 1.0 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 31 1.8 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 30 3.1 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 30 3.1 SB_47581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 29 4.1 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 29 4.1 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.5 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 29 5.5 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 29 5.5 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 29 5.5 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 7.2 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 29 7.2 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 7.2 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 29 7.2 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 28 9.6 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXG 596 PP GG G PPPPPP G PP PP GG P P G Sbjct: 663 PPPPPPGGQAGGAPPPPPPPLPGGAAPPP-----PPPIGGGAPPPPPPG 706 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 36.7 bits (81), Expect = 0.027 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXG 596 PP GG PPPPPP PP G P GN P P G Sbjct: 355 PPPVGGAAP----PPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPG 399 Score = 32.7 bits (71), Expect = 0.44 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXPXGXXP 644 G PPPPP PP G PP ++P P G P G P Sbjct: 323 GTAPPPPPPSRSSQRPPPPSRGAPPPP-SMGMAPPPVGGAAPPPPPPPPVGGPP 375 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 G PPPPP G PP G PP +P P Sbjct: 284 GIQPPPPPS--RGAAPPPPSRGAPPPPPSRGSAPPP 317 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 492 PPPPPKXXXGXXXPPAXTGXXPP 560 PPPPP PPA G PP Sbjct: 305 PPPPPSRGSAPPPPPARMGTAPP 327 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 33.9 bits (74), Expect = 0.19 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 10/59 (16%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPP--------PPPKXXXGXXXPP--AXTGXXPPXGGNXVSPKPXG 596 PP G GG G PPP PPP G PP A G PP G P P G Sbjct: 538 PPGAGQGG---GPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPG 593 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXT--GXXPPXGGNXVSPKPXG 596 PP G G G PPPP G P A G PP G P P G Sbjct: 503 PPPPGAG--QGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPG 551 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 12/56 (21%) Frame = +3 Query: 465 GGGXXXGXPP--------PPPPKXXXGXXXPPAXT----GXXPPXGGNXVSPKPXG 596 GGG G PP PPPP G PP G PP G P P G Sbjct: 485 GGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPG 540 Score = 31.1 bits (67), Expect = 1.4 Identities = 33/126 (26%), Positives = 36/126 (28%) Frame = +3 Query: 192 GXXPPGXXXPXXXGXGPPTXXXTXXXXGXPXPKXGEKNAXXXKTXXQWXXXKPXXXAKXX 371 G PPG G GPP G P P G+ Q P + Sbjct: 491 GQPPPGAGQ----GGGPPPPG-AGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGG 545 Query: 372 XPPXMXSXXXSXSXGXXGRFFXXXXTPPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGX 551 PP + G PP G GG PPPP G P A G Sbjct: 546 GPPPPGAGQ-GWGQPPPGAGQGGGPPPPGAGQGG------PPPPGAGQEGPPPPGAGQGG 598 Query: 552 XPPXGG 569 PP G Sbjct: 599 GPPPPG 604 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +3 Query: 492 PPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXPXGXXPKTA 653 PPPPP G PP T PP P P P S G P A Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPSEGKCGRKPAGA 427 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = +3 Query: 465 GGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP---XGXPXKTIXSXXPXG 635 GGG G PPPPP PP PP N P P G P + P Sbjct: 340 GGG---GVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPP 396 Query: 636 XXPKT 650 P T Sbjct: 397 PPPPT 401 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPPAXTGXXPP 560 G PPPPPP G PP T PP Sbjct: 383 GPPPPPPP--TNGPPPPPPPTNGPPP 406 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 465 GGGXXXGXPPPPPPKXXXGXXXPPA 539 GG PPPPPP G PP+ Sbjct: 69 GGAPSTPAPPPPPPPPSSGPPLPPS 93 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPPAXTGXXPPXG 566 G PPPPPP G PP T P G Sbjct: 393 GPPPPPPP--TNGPPPPPPPTNGPPSEG 418 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXP 629 G PPPPPP P PP P P G P K P Sbjct: 775 GAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLP 823 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTG----XXPPXGGNXVSPKP 590 PPPPPP PP G PP GGN P P Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPP 957 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXG 596 PP GG PPPPP PP PP +P P G Sbjct: 923 PPPPGGNAPL---PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGG 968 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 8/59 (13%) Frame = +3 Query: 450 PPXXGGGGXXXGXPP-----PPPPKXXXGXXXPPAXTG---XXPPXGGNXVSPKPXGXP 602 PP GG PP PPPP G PP G PP GG+ P P P Sbjct: 934 PPPPGGSAPSQPPPPGGNAPPPPP--PPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPP--------PPPKXXXGXXXPPAXTGXXPPXGGN--XVSPKPXG 596 PP GG PPP PPP PP G PP GG + P P G Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGG 979 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 595 PXGLGETXFPPXGGXXPVXAGGXXXPXXFLGGGGGGXPXXKPPPP 461 P G PP GG P GG P GG P PPPP Sbjct: 948 PGGNAPPPPPPPGGSAPPPGGGAP-PLPPPPGGSAPPPPPPPPPP 991 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPP 560 PP GG G PP P G PP PP Sbjct: 956 PPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXP 557 PP G G PPPPPP G PPA G P Sbjct: 198 PPPPPPPGFPGGAPPPPPP--PFGAPPPPALNGGPP 231 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXT-GXXPPXGGNXVSPK 587 PPPPPP G PP G PP N P+ Sbjct: 199 PPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPPR 232 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPP 536 PP GG PPPPPP G PP Sbjct: 306 PPPPPGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 31.9 bits (69), Expect = 0.78 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PP G PPPPPP PP PP G+ +P P P Sbjct: 292 PPPPPADGSAPAPPPPPPP-----GGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 7/54 (12%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPP-------PPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 P GGG PPP PPP G PP PP G P P Sbjct: 281 PDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXT 545 PP GG PPPPPP PP T Sbjct: 307 PPPPGGAPPPPPPPPPPPPGDGGAPPPPPPPT 338 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTG----XXPPXGGNXVSPKPXGXP 602 PP GG G PPP PP PP T PP G P P P Sbjct: 388 PPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPP 442 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 31.9 bits (69), Expect = 0.78 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +3 Query: 450 PPXXGG----GGXXXGXPPPPPPKXXXGXXXPP 536 PP GG GG G PPPPPP PP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 31.9 bits (69), Expect = 0.78 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = +3 Query: 483 GXPPP-PPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXPXGXXPKTAF 656 G PP PPP PP T PP G + P G P S P G +T F Sbjct: 2178 GAPPSGPPPMGAPPSGPPPMGT---PPSGHPPMGAPPMGPPPSGSHSPAPRGTISQTCF 2233 Score = 28.3 bits (60), Expect = 9.6 Identities = 22/78 (28%), Positives = 22/78 (28%), Gaps = 2/78 (2%) Frame = +3 Query: 375 PPXMXSXXXSXSXGXXGRFFXXXXTPPXXGGGGXXXGXPPPPPPKXXXGXXXPP--AXTG 548 PP M G G PP G G PPP P P A Sbjct: 2115 PPSMGRYNTPPPMGQYGAPARPAMGPPPMGSS--RYGPPPPMGPARHSPSGPSPLGAPPS 2172 Query: 549 XXPPXGGNXVSPKPXGXP 602 PP G P P G P Sbjct: 2173 VPPPMGAPPSGPPPMGAP 2190 >SB_4337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 423 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 PP G G G PP G PP G PP G P P Sbjct: 253 PPGQQGYGAPPGQQGYGPPLGQQGYGPPPGQQGYGPPPGQQGYGPPP 299 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXG 596 PP G G G PP G PP G PP G P P G Sbjct: 280 PPGQQGYGPPPGQQGYGPPPGQQGYGSPPGQQGYGPPPGQQGYGP-PAG 327 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = +3 Query: 447 TPPXXGGGGXXXGXPPPP----PPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 +P G G G PP PP G PP G PP G P P Sbjct: 230 SPGQHQGYGTLPGPPPGQQGYGPPPGQQGYGAPPGQQGYGPPLGQQGYGPPP 281 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 PP G G G PP G PP G PP G P Sbjct: 262 PPGQQGYGPPLGQQGYGPPPGQQGYGPPPGQQGYGPPPGQQGYGSPP 308 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 432 FXXXXTPPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGN 572 F PP GGG PPPPPP G PP PP GN Sbjct: 648 FFGGIPPPPPGGG----MFPPPPPPPPGGGVPGPP-----KPPPPGN 685 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -3 Query: 568 PPXGGXXPVXAGGXXXPXXFLGGGGGGXPXX-KPPPP 461 P GG P GG P GGG P KPPPP Sbjct: 647 PFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +3 Query: 375 PPXMXSXXXSXSXGXXGRFFXXXXTPPXXGGGGXXXGXPPPPPPKXXXGXXXPPA 539 PP G G + PP GG G PPPPP G PPA Sbjct: 606 PPHGGHPHHPPPTGYPGGYPGTHTAPP---AGGYPTGQHPPPPPAGYPGYGPPPA 657 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +3 Query: 483 GXPPPPPPKXXXGXXXPPAXTGXXP----PXGGNXVSPKPXGXP 602 G P P P G PP +G P P GG+ P P G P Sbjct: 578 GYPAPTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYP 621 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKT 611 PPPPPP PP PP + P G P T Sbjct: 692 PPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGT 732 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/54 (27%), Positives = 17/54 (31%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXPXGXXPKT 650 PPPPPP+ PP PP P P + P P T Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPT 257 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTG-XXPPXGGNXVSP---KPXGXP 602 PP G G G PPP P G P G PP G +P +P G P Sbjct: 45 PPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQPYGAP 99 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.9 bits (64), Expect = 3.1 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +3 Query: 468 GGXXXGXPP--PPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXPXGXX 641 GG PP PPPP G PP G PP G P P G P P Sbjct: 448 GGGPPQLPPNLPPPPGGMRGMPPPPM--GMYPPPRG--FPPPPFGPPPPFYRGPPPPRGM 503 Query: 642 P 644 P Sbjct: 504 P 504 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 4/55 (7%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAX----TGXXPPXGGNXVSPKPXGXP 602 PP G PPPPPP PA PP GG P P P Sbjct: 151 PPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPP 536 PP GG PPPPPP PP Sbjct: 189 PPPSGGPPPPPPPPPPPPPPPILELAAPP 217 >SB_47581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 447 TPPXXGGGGXXXGXPPPPPP 506 TP GGGG PP PPP Sbjct: 5 TPQVGGGGGGSASFPPSPPP 24 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PP G PPPPPP G PP P G + P P P Sbjct: 701 PPPLLSGTLPMPPPPPPPPPGCAGLPPPP----PSPQPGCAGLPPPPPPPP 747 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 453 PXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 P G PPPPPP P PP G + P P Sbjct: 684 PVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPP 729 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTI 614 PP G PPPPP PP P G P P P K + Sbjct: 713 PPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKPL 767 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPPPPP G P PP P P P Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPPPPP PP PP P P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXPXGXXP 644 PPPPPP PP PP P P P P P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPPPPP PP PP P P P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PPPPPP PP + PP P P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 28.3 bits (60), Expect = 9.6 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXPXGXXPKTAFXLA 665 PPPPPP P PP P P P P P A LA Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLA 437 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXP 629 PPPPPP PP PP P P P + P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 26.2 bits (55), Expect(2) = 4.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPP 506 P G GG PPPPPP Sbjct: 784 PEGEGVGGITPPPPPPPPP 802 Score = 21.4 bits (43), Expect(2) = 4.5 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +3 Query: 489 PPPPPPK 509 PPPPPP+ Sbjct: 800 PPPPPPE 806 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/52 (30%), Positives = 19/52 (36%) Frame = -3 Query: 568 PPXGGXXPVXAGGXXXPXXFLGGGGGGXPXXKPPPPXXGGVXXXXKNLPXXP 413 PP G P P + G GG P PPP GG+ + P P Sbjct: 248 PPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPP 299 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPP 560 PPPPPP PP T PP Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPP 324 >SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) Length = 592 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/54 (25%), Positives = 17/54 (31%) Frame = +3 Query: 495 PPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXPXGXXPKTAF 656 PP P+ PP PP +P P P + S P P F Sbjct: 70 PPAPQPVPNNMGPPPHVNQGPPPNSANQAPPPNPGPSPSFNSQGPPQRLPLQGF 123 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXP 602 PP G G P PK G PP G P G + P G P Sbjct: 44 PPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLP 94 Score = 28.7 bits (61), Expect = 7.2 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKPXGXPXKTIXSXXP 629 PP G G P PP P+ G P G P G N P G P P Sbjct: 272 PPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNG----PLGPPGDVGPPGNP 327 Query: 630 XG 635 G Sbjct: 328 GG 329 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 PPPPPP PPA + P G S P Sbjct: 870 PPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 6/53 (11%) Frame = +3 Query: 432 FXXXXTPPXXGGGGXXXGXPPPPP------PKXXXGXXXPPAXTGXXPPXGGN 572 F PP G PPPP K G PP G PP GN Sbjct: 128 FRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGN 180 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/51 (29%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 453 PXXGGGGXXXGXPPPPPPKXXXGXXXPP-AXTGXXPPXGGNXVSPKPXGXP 602 P G PPPPP PP +G PP G S + P Sbjct: 182 PTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPP 232 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/49 (30%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP--XGXPXKTIXSXXP 629 PPPP G PP PP G+ P P G P + + P Sbjct: 250 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 298 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPP--KXXXGXXXPP 536 PP G G PPPPPP + G PP Sbjct: 358 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPP 388 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +3 Query: 492 PPPPPKXXXGXXXPPAXTGXXPPXG--GNXVSPKPXGXP 602 PPPPP G P G P G G P P G P Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLP 1700 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 6/53 (11%) Frame = +3 Query: 432 FXXXXTPPXXGGGGXXXGXPPPPP------PKXXXGXXXPPAXTGXXPPXGGN 572 F PP G PPPP K G PP G PP GN Sbjct: 40 FRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGN 92 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/51 (29%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 453 PXXGGGGXXXGXPPPPPPKXXXGXXXPP-AXTGXXPPXGGNXVSPKPXGXP 602 P G PPPPP PP +G PP G S + P Sbjct: 94 PTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPP 144 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/49 (30%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 489 PPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP--XGXPXKTIXSXXP 629 PPPP G PP PP G+ P P G P + + P Sbjct: 162 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 210 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +3 Query: 450 PPXXGGGGXXXGXPPPPPP--KXXXGXXXPP 536 PP G G PPPPPP + G PP Sbjct: 270 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPP 300 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 28.3 bits (60), Expect = 9.6 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 423 GRFFXXXXTPPXXGGGGXXXGXPPPPPPKXXXGXXXPPAXTGXXPPXGGNXVSPKP 590 GR P GG G G PPP PP P +G PP P P Sbjct: 206 GRGMGKRFPPGRPGGPGMPPGGPPPFPPTSDPNMGHHPPISG--PPTTSMSGPPIP 259 >SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1411 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +3 Query: 453 PXXGGGGXXXGXPPPPP--PKXXXG 521 P GGGG G PPPP PK G Sbjct: 713 PSPGGGGGHSGTPPPPEIGPKSFYG 737 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,361,219 Number of Sequences: 59808 Number of extensions: 248073 Number of successful extensions: 1590 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1111 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2764790632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -