BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J06 (907 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0354 + 9283886-9285505,9287158-9287251,9287817-9289915 33 0.41 04_04_0759 - 27832340-27832480,27832568-27832593,27832759-27834154 29 5.1 >02_02_0354 + 9283886-9285505,9287158-9287251,9287817-9289915 Length = 1270 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/66 (27%), Positives = 29/66 (43%) Frame = -3 Query: 317 RCSVSFRSWYLNTASMAHSTRLKLQYLKYFTIRLTQHARYILVITHCRRLLHSRCT*CGT 138 RC F SW++ A H+++ L LK TI + + V++ L R C Sbjct: 1025 RCGKIFASWFMVEAGTHHTSKPFLAPLKELTIYSESSVQSMAVLSSLTSLTRLRLVDCDN 1084 Query: 137 LVIILF 120 L ++ F Sbjct: 1085 LTVVGF 1090 >04_04_0759 - 27832340-27832480,27832568-27832593,27832759-27834154 Length = 520 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 Query: 50 FXVVPATPGRPRPVRASPSN 109 F VP TP RPRP A+P+N Sbjct: 333 FNNVPPTPLRPRPATAAPTN 352 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,576,759 Number of Sequences: 37544 Number of extensions: 537233 Number of successful extensions: 1334 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1334 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2565528060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -