BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_J02 (920 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces... 105 1e-23 SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr ... 26 8.6 >SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces pombe|chr 1|||Manual Length = 113 Score = 105 bits (251), Expect = 1e-23 Identities = 54/106 (50%), Positives = 71/106 (66%) Frame = +2 Query: 107 ASKGKSAINAVVTRESTVNLHKRLHGVGFKKRAPXAIKEIRKFAEKQMGTPDIRVXTRLN 286 A+ KSAIN VVTR+ T+++HKRL+GV FKKRAP AIKEI FA+K M T ++RV LN Sbjct: 2 ANTKKSAINQVVTRDYTIHMHKRLYGVSFKKRAPRAIKEIVAFAQKHMQTKEVRVDPSLN 61 Query: 287 KFLWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIK 424 K +W +G+RNVP +D++D A L+T V V VA+ K Sbjct: 62 KEVWKRGIRNVPHRLRLRLSRKRSDEDDKA--LYTYVQAVDVANPK 105 >SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 25.8 bits (54), Expect = 8.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 468 GVYSWLASTFSVCKPLID 415 GV WLAST+S C +++ Sbjct: 464 GVVCWLASTYSFCDGIVN 481 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,652,484 Number of Sequences: 5004 Number of extensions: 43083 Number of successful extensions: 82 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 468512460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -