BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_I22 (909 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 24 1.7 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 24.2 bits (50), Expect = 1.7 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 7/49 (14%) Frame = -1 Query: 153 DKSAGVVYIHITVXG*QSRTRHA-TDARD-----SWR-SKLKILRNSTS 28 D A VVY H+TV G S ++ T A D +W+ ++L++ N TS Sbjct: 57 DGQATVVYFHVTVMGLDSIDENSMTYAADIFFAQTWKDNRLRLPENMTS 105 Score = 21.8 bits (44), Expect = 8.9 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 855 PPXXPPXPXPGSSXP 899 P PP P P SS P Sbjct: 339 PKPAPPPPPPSSSGP 353 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,961 Number of Sequences: 438 Number of extensions: 3564 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29509116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -