BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_I19 (927 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 47 2e-05 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 39 0.005 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 39 0.005 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 39 0.005 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 36 0.061 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.061 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 36 0.061 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 35 0.081 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 35 0.11 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 35 0.11 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 34 0.14 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 34 0.14 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 34 0.14 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 33 0.25 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 33 0.25 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 33 0.25 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 33 0.25 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 33 0.33 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.76 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.76 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 31 1.3 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 31 1.3 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 31 1.7 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 31 1.7 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 30 2.3 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 30 2.3 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 30 3.1 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 30 3.1 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 30 3.1 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 29 4.0 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 29 4.0 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 29 4.0 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 5.3 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 29 7.1 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 29 7.1 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 29 7.1 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 28 9.3 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 28 9.3 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/63 (63%), Positives = 49/63 (77%) Frame = +2 Query: 110 LGAXXXXQXLYXXKLSXVMRFLLRVXVWQYRQLTRMHRAPRPTRPDKARXLGYRAKQGYV 289 +GA + LY K S ++RFLLRV WQYRQLT +HRA RPTRPDKAR LGY+AKQG+V Sbjct: 1 MGAYKYLEELYKKKQSDLLRFLLRVRCWQYRQLTAIHRATRPTRPDKARRLGYKAKQGFV 60 Query: 290 VFR 298 ++R Sbjct: 61 IYR 63 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P P PP PP PPP PPP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P P PP PP PPP PPP P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P P PP PP PPP PPP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PPP P P P P PP PP PPP PPP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PPP P P P P PP PP PPP PPP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P P P P P P P PP PP PPP PPP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P P PP PP PPP P P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P P PP PP PPP PP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P P PP PP PP PPP P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PP P P P P PP PP PPP PPP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PPP P P P P P PP PPP PPP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 P P P P P P P P PP PP PPP PPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPP 881 P P PPP P P P P PP PP Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G G GGG G Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GGG GG GG G G G G GGG G Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 36.3 bits (80), Expect = 0.035 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GG GGG GG GG G G G G GGG G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGG 817 Score = 36.3 bits (80), Expect = 0.035 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GG GG GG G G G G GGG G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGG 821 Score = 35.1 bits (77), Expect = 0.081 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GGG GG GG G G G GGG G Sbjct: 814 GGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGG 856 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG G G G G G GGG Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG GG G G G G G G Sbjct: 791 GGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDG 833 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GGG GG G G G G G GGG G Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGG 854 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG G G G G GGG G Sbjct: 815 GGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGG 860 Score = 33.5 bits (73), Expect = 0.25 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GG GGG GG GG G G G GGG G Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 33.5 bits (73), Expect = 0.25 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G G G GGG GG G G G G G GGG G Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 33.1 bits (72), Expect = 0.33 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 919 GXXGGGXXGGGXXGG-XXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG GG G G G G GGG Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 32.7 bits (71), Expect = 0.43 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG G G G G G G GGG G Sbjct: 813 GGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGG 858 Score = 32.7 bits (71), Expect = 0.43 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG G G G G G G GGG G Sbjct: 819 GGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Score = 32.7 bits (71), Expect = 0.43 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GG GGG G GG G G G G GGG G Sbjct: 825 GDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 32.7 bits (71), Expect = 0.43 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GG GGG G GG G G G G GGG G Sbjct: 831 GDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = -3 Query: 919 GXXGGGXXGGG---XXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG GG G G G G GGG Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGG 841 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G G GGG GG G G G G G GGG G Sbjct: 810 GDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGG 852 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG G G G GG G G G GGG G Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGG 862 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 7/53 (13%) Frame = -3 Query: 919 GXXGGGXXGG-------GXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GG G GG GG G G G G GGG G Sbjct: 820 GGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 28.7 bits (61), Expect = 7.1 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 GGG GGG G GG G G G G GGG Sbjct: 769 GGG--GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 PPP P P P PP PP PPP PPP Sbjct: 955 PPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPP 908 P P PPP P P PP PP PPP PP Sbjct: 946 PPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPP--XXPPPXXP 920 P P PPP P P PP PP PPP PPP P Sbjct: 935 PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGA--PPLPPPPGGSAPPPPPP 987 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 5/45 (11%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXX-----PPXXXXXXXPPXXPPPXXPPP 911 PPP P P P P PP PP PP PP Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPP 965 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G G GGG G Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 36.3 bits (80), Expect = 0.035 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG G G G G G GGG G Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 36.3 bits (80), Expect = 0.035 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G GGG G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 33.5 bits (73), Expect = 0.25 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG G G G G GGG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 33.5 bits (73), Expect = 0.25 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG G G G G GGG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG G GG G G G G GGG G Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG---GGGGGGGGVG 114 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G G GGG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 36.7 bits (81), Expect = 0.027 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G G GG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 35.1 bits (77), Expect = 0.081 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG GG G G G G G G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G G G GGG GG GG G G G G GGG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G G GGG GG GG G G G G GGG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G G G G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 31.9 bits (69), Expect = 0.76 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG GG G G G G G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G G G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXG 803 G GGG GGG GG GG G G G G Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXG 797 G GGG GGG GG GG G G G G Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG GG G G G G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PPP P P P P PP PP PPP P P P Sbjct: 147 PYPPPPNPPYPP-PLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPP 191 Score = 35.5 bits (78), Expect = 0.061 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PPP P P P P P P PPP PPP P Sbjct: 123 PYPPPPNPPYPPPPNA-PYPPSPNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 35.5 bits (78), Expect = 0.061 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P PP PP PPP P P P Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 35.5 bits (78), Expect = 0.061 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PP P P P P PP PP PPP P P P Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPN-PPYPPPPNAPNPPPP 207 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PPP P P P P PP PP PPP P Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAP 218 Score = 35.1 bits (77), Expect = 0.081 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P P P P P PP P PPP PPP P Sbjct: 128 PNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAP 173 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXP-PPXXPPPXXP 920 P P PPP P P P PP PP P PP PPP P Sbjct: 178 PYPPPPNPPYPPPPNPPYPPPPNAPNP--PPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXP--PXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P P P PP PP PPP P Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP 139 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 P P P P P P P PP PP P P PPP Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPP 225 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 P P PPP P P P PP PP PPP PPP Sbjct: 123 PYPPPPNPPYPPP-PNAPYPP--SPNAPYPPPPNPPYPPPLYPPPPNPPP 169 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXX--PXPXXP-PXXXXXXXPPXXPPPXXPPPXXP 920 P PPP P P P P P P PP PPP P P P Sbjct: 186 PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYP 234 Score = 33.1 bits (72), Expect = 0.33 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXX-PXPXXPPXXXXXXXPPXXPPP---XXPPPXXP 920 P PPP P P P PP PP PPP PPP P Sbjct: 131 PYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYP 180 Score = 32.7 bits (71), Expect = 0.43 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PPP P P P P PP PP P P PPP P Sbjct: 202 PNPPPPNPPYPPPPNA-PNPPYPP-------PPNAPNPPYPPPPNP 239 Score = 32.3 bits (70), Expect = 0.57 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P P PP PPP P P P Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAP-YPPPPNPPYPPPPNAPYPPSP 144 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXP-XXXPXPXXPPXXXXXXXP-PXXPPPXXPPPXXP 920 P P PPP P P P P PP P P P PPP P Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP 154 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PP P P P P P PP P P P P P Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYP 196 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P P PPP PP P Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P P P P P P PP P P P P P P Sbjct: 105 PPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYP 157 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 PPP P P P PP PP PPP PP P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 35.9 bits (79), Expect = 0.046 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P PP PP PPP PP P Sbjct: 347 PPPPTNNPPSPPP-PTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 35.5 bits (78), Expect = 0.061 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 PPP P P P PP PP PPP PP Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 PPP P P PP PP PPP PP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 33.5 bits (73), Expect = 0.25 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +3 Query: 762 PXXXXXXPXXPPPX--PXXXXXPXXXPXPXXPPXXXXXXXPPXX--PPPXXPPPXXP 920 P P PPP P P P P PP PP PPP PP P Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P PP PP P PPP P Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXX---PPXXXXXXXPPXXPPPXXPP 908 PPP P P P P PP PP PP PP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PP P P PP PP PP PPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNK--PPPPPPPTNGPPPPPP 389 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 35.5 bits (78), Expect = 0.061 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GG GGG GG GG G G G G GGG G Sbjct: 137 GGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 Score = 35.5 bits (78), Expect = 0.061 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G GGG G Sbjct: 175 GYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYG 220 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXG-XXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G G GGG G Sbjct: 179 GGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSG 225 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG G G G G G GGG Sbjct: 169 GGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGG 211 Score = 32.7 bits (71), Expect = 0.43 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G G G GGG GG GG G G G GGG G Sbjct: 160 GYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGG 205 Score = 32.7 bits (71), Expect = 0.43 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG G G G G G GG Sbjct: 184 GGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGG 226 Score = 32.3 bits (70), Expect = 0.57 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GG G GG G G G G GGG G Sbjct: 147 GYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYG 192 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GGG G G G G G G GGG G Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHG 187 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G G GG G Sbjct: 174 GGYGGGGYGGGGHGG--GGYGGGGYGGGGGGYGGSGYGGGGGYGGG 217 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG G G G G GGG Sbjct: 185 GHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GGG GG GG G G G GGG G Sbjct: 124 GGGRRGGGYGGG---RGGGGGYRSGGGYRGGGGYRGGGGGYRG 163 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 35.5 bits (78), Expect = 0.061 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG G GG G G G G GGG G Sbjct: 1797 GMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGG 1842 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GGG G GG G G G G GGG G Sbjct: 1770 GGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGG 1812 Score = 32.3 bits (70), Expect = 0.57 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G G G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGG 1801 Score = 31.9 bits (69), Expect = 0.76 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GGG G G G G G G GGG G Sbjct: 1777 GGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGG 1819 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG G GG G G G GG G Sbjct: 1761 GGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGG 1806 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GGG G G G G G GGG G Sbjct: 1776 GGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMG 1818 Score = 29.1 bits (62), Expect = 5.3 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GG G GG G G G G GGG G Sbjct: 1779 GMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMG-GGGGGMGGGGEG 1823 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G G GGG GG GG G G G G G G Sbjct: 1795 GEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEG 1837 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 35.5 bits (78), Expect = 0.061 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 7/50 (14%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPP-------PXXPPPXXP 920 PPP P P P P PP PP PP P PPP P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 795 PPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 PP P P P P P PPP PPP P Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P PP P PPP P Sbjct: 117 PETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 P PP P P P PP PPP PPP Sbjct: 165 PPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PPP P PP PPP PPP P Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/47 (31%), Positives = 15/47 (31%), Gaps = 1/47 (2%) Frame = +3 Query: 783 PXXPPPXP-XXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PP P P P P P PP P PPP P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPP 156 Score = 28.3 bits (60), Expect = 9.3 Identities = 17/60 (28%), Positives = 17/60 (28%), Gaps = 7/60 (11%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPP-------PXXPPPXXP 920 P P P P P P PP PP PP P PPP P Sbjct: 113 PPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAP 172 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 35.1 bits (77), Expect = 0.081 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G G GGG G Sbjct: 81 GGRGGGFGGGGGFGG-GGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 33.1 bits (72), Expect = 0.33 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG GG G G G G GGG Sbjct: 86 GFGGGGGFGGG--GGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG GG G G G G G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDG 348 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG G G G G G G G Sbjct: 312 GDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 P P PPP P P P PP PP P PPP Sbjct: 356 PPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 795 PPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 PP P P PP PP PP PPP P Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 PPP P P P P PP PP PP P Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 4/44 (9%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPP----XXPPPXXPPP 911 PPP P P PP PP PPP PPP Sbjct: 327 PPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 PPP P P PP PP PP PP Sbjct: 347 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPP 386 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 834 PXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PP PP PPP PPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 PPP P P P P PP PP PPP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPP-------PPPFPPPPPPTP 496 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 840 PXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PP PP PPP PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 822 PXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P P PP PP PP PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 P PPP P P P PP PPP PPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 4/57 (7%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPP----XXPPPXXP 920 P P PPP P P P P PP PPP PPP P Sbjct: 703 PLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 32.7 bits (71), Expect = 0.43 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 5/51 (9%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPP-----XXPPPXXP 920 P PPP P P P PP PP P P PPP P Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPP 745 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 PPP P P P PP PP PPP P P Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPPPGCAGLPP--PPPPIDVPMKP 766 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 PPP P P P P PP PP PPP P P Sbjct: 204 PPPPPPR---PPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 33.1 bits (72), Expect = 0.33 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXP----PXXXXXXXPPXXP--PPXXPPP 911 P P PPP P P P P P P PP P PP PPP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P PP P P P PP P Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 Score = 32.7 bits (71), Expect = 0.43 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PPP P P P P PP PP PPP P P P Sbjct: 204 PPPPPPRP-----PPSPPPPPPPPSPS----PPRPPPPPPPSPPRP 240 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 795 PPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P P P P PP PP PP PPP P Sbjct: 195 PTSPSQITQPPPPP-PRPPPSPPPPPPPPSPSPPRPPPPPPP 235 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +3 Query: 762 PXXXXXXPXXPPPX-PXXXXXPXXXPXPXXPPXXXXXXX--PPXXPPPXXPPPXXP 920 P P PPP P P P P PP PP P P PPP P Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 487 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +3 Query: 762 PXXXXXXPXXPPPX-PXXXXXPXXXPXPXXPPXXXXXXX--PPXXPPPXXPPPXXP 920 P P PPP P P P P PP PP P P PPP P Sbjct: 442 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 497 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +3 Query: 762 PXXXXXXPXXPPPX-PXXXXXPXXXPXPXXPPXXXXXXX--PPXXPPPXXPPPXXP 920 P P PPP P P P P PP PP P P PPP P Sbjct: 462 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAP 517 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +3 Query: 762 PXXXXXXPXXPPPX-PXXXXXPXXXPXPXXPPXXXXXXX--PPXXPPPXXPPPXXP 920 P P PPP P P P P PP PP P P PPP P Sbjct: 522 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAP 577 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +3 Query: 762 PXXXXXXPXXPPPX-PXXXXXPXXXPXPXXPPXXXXXXX--PPXXPPPXXPPPXXP 920 P P PPP P P P P PP PP P P PPP P Sbjct: 552 PPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +3 Query: 783 PXXPPPX-PXXXXXPXXXPXPXXPPXXXXXXX--PPXXPPPXXPPPXXP 920 P PPP P P P P PP PP P P PPP P Sbjct: 429 PRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 477 Score = 32.3 bits (70), Expect = 0.57 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXX--PPXXPPPXXPPPXXP 920 PP P P P P PP PP P P PPP P Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAP 467 Score = 32.3 bits (70), Expect = 0.57 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXX--PPXXPPPXXPPPXXP 920 PP P P P P PP PP P P PPP P Sbjct: 503 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 547 Score = 31.9 bits (69), Expect = 0.76 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 762 PXXXXXXPXXPPPX-PXXXXXPXXXPXPXXPPXXXXXXX--PPXXPPPXXPPP 911 P P PPP P P P P PP PP P P PPP Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 554 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +3 Query: 762 PXXXXXXPXXPPPX-PXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P P PP P PPP P P P Sbjct: 482 PPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPH---PRVPPPGAPHPRVP 532 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = +3 Query: 762 PXXXXXXPXXPPPX-PXXXXXPXXXPXPXXPPXXXXXXX--PPXXPPPXXPPPXXP 920 P P PPP P P P PP PP P P PPP P Sbjct: 532 PPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP 587 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P PP PPP P P P Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPP 95 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Frame = +3 Query: 762 PXXXXXXPXXPPPX---PXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P PP PP P PPP P Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 795 PPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPP 908 PP P P P P PP PP P P PP Sbjct: 315 PPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPP 352 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXP-PPXXP 920 P PP P P P PP PP P P P PP P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSP 218 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 795 PPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 PP P P P P PP PP P P P P P Sbjct: 245 PPMPETPLPPAT-PNPFIPPASPNPSIPPAPPNPSIPAPPNP 285 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +3 Query: 795 PPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPP-PXXP 920 PP P P P P PP P P P PP P P Sbjct: 297 PPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNP 339 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 5/51 (9%) Frame = +3 Query: 783 PXXPP----PXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPP-PXXP 920 P PP P P P P P PP P P P PP P P Sbjct: 271 PPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNP 321 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG GG G G G G GGG Sbjct: 70 GDDGGG-DGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 111 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G G GGG GG G G G G G GGG G Sbjct: 65 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 110 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG G G GG G G G G GGG Sbjct: 51 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGG 93 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 33.5 bits (73), Expect = 0.25 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G G G G Sbjct: 200 GGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -3 Query: 910 GGGXXGG--GXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 GGG GG G GG GG G G G G GGG Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGG 232 Score = 30.3 bits (65), Expect = 2.3 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 919 GXXGGG-XXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G G GGG G Sbjct: 182 GSQGGGYRSGGGGYGG--SKGGYGGGSGGGGYGGGRGGGGYGGGHGG 226 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GGG G G G G G GGG G Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGG 222 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG GG G G G G GGG Sbjct: 85 GDDGGG-DGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 126 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G G GGG GG G G G G G GGG G Sbjct: 80 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 125 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG G G GG G G G G GGG Sbjct: 66 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGG 108 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPP----XXPPPXXP 920 PPP P P P P PP PP PPP PPP P Sbjct: 292 PPPPPADGSAPAPPPPP--PPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPP 896 P P PPP P P P P PP PP PPP Sbjct: 295 PPADGSAPAPPPPPPPGGAPP--PPPPPPPPPPGDGGAPPPPPPP 337 Score = 31.9 bits (69), Expect = 0.76 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 P PPP P P PP PP PPP PPP Sbjct: 290 PVPPPP-------PADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 834 PXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PP PP PPP PP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPP 318 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.5 bits (73), Expect = 0.25 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +3 Query: 762 PXXXXXXPXXPPPX-PXXXXXPXXXPXPXXPPXXXXXXX--PPXXPPPXXPPPXXP 920 P P PPP P P P P PP PP P P PPP P Sbjct: 53 PPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTP 108 Score = 33.5 bits (73), Expect = 0.25 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +3 Query: 762 PXXXXXXPXXPPPX-PXXXXXPXXXPXPXXPPXXXXXXX--PPXXPPPXXPPPXXP 920 P P PPP P P P P PP PP P P PPP P Sbjct: 63 PPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTP 118 Score = 31.9 bits (69), Expect = 0.76 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXX--PPXXPPPXXPPPXXP 920 PP P P P P PP PP P P PPP P Sbjct: 44 PPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTP 88 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +3 Query: 783 PXXPPPX-PXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PPP P P P P PP P PPP P P P Sbjct: 50 PGDPPPNIPIPGNPPPNTPIPGDPPPNTPI---PGDPPPNTPIPGNP 93 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 33.1 bits (72), Expect = 0.33 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 919 GXXGGGXX-GGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG GG G G G G GGG Sbjct: 186 GSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGG 229 Score = 29.1 bits (62), Expect = 5.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -3 Query: 910 GGGXXGGG--XXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GGG GG GG G G G GGG G Sbjct: 184 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGG 228 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 32.3 bits (70), Expect = 0.57 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 834 PXPXXPPXXXXXXXPPXXPPPXXPPP 911 P P PP PP PPP PPP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 834 PXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PP P PPP PPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 822 PXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 P P P PP PP PPP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPP 896 PPP P P P P PP PP PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPP-------PPPPPPP 1184 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 31.9 bits (69), Expect = 0.76 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G G G G G GG GG G G G G GGG Sbjct: 214 GVIGTGVIGAGAVGGLGGLGGLGGVGGLGGVGGLGGIGGLGGG 256 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 840 PXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PP PP PPP PPP P Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PPP P P P PPP PPP P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAP 148 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 P P P P P P P P PP PP PPP Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPP 204 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GGG GG GG G G G G GGG G Sbjct: 133 GGGGGGGGGGGG-------GGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXG 803 G GGG GGG GG GG G G G G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXG 821 G GGG GGG GG GG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXG 821 G GGG GGG GG GG G G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXG 821 G GGG GGG GG GG G G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 895 GGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 GGG GG GG G G G G GGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 834 PXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PP PP P P PPP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPP 908 PPP P P P P PP PP PPP PP Sbjct: 683 PPPPPP----PPPPPPPPPPPPPQPSTPPP--PPPSTPP 715 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPP 893 P P PPP P P P P PP PP PP Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPP-----PPPPSTPP 715 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 834 PXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PP PP PPP P P P Sbjct: 7 PPPPPPPIAAEFTAPPAPPPPPNPAPDVP 35 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPP---XXPPPXXP 920 PPP P P P PP PP PPP PPP P Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGGAAPPP--PPPIGGGAPPPPPP 705 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG GG G G G GGG G Sbjct: 41 GGGGGGGGGGGGGGG------GGGGDGDGDGDGDANANADGGGGGG 80 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 GGG GGG GG G G G G GGG Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGG 81 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 907 GGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GG GGG GG G G G G GGG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGG 82 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GG GG G GG G G G G GGG G Sbjct: 90 GSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGG 135 Score = 28.3 bits (60), Expect = 9.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXG--XGGG 791 G GGG GGG GG GG G G G G GGG Sbjct: 109 GGYGGG-RGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGG 152 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG G G G G G GGG G Sbjct: 38 GVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAG 83 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG GG G G G G G GG G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAG--GCGCGGGNDGGNGGGGAGNG 76 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXG-GXXGXGXXXGXXXXXGXGGGXXG 782 G G G GGG GG G G G G G GGG G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAG 74 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG G G G G G GGG Sbjct: 443 GGDGGGDGGGGGDGG-GDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G G GGG GG G G G G G GGG G Sbjct: 441 GRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGG 483 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 GGG GGG GG GG G G G G GGG Sbjct: 756 GGGYRGGGGYGGGGGGYRGGGGYGGGHRGG----GGYGGG 791 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G GGG GGG G GG G G G G G G Sbjct: 758 GYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRG 803 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 907 GGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GG GGG GG G G G G GGG G Sbjct: 730 GGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGG 771 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 919 GXXGGGXX-GGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GGG GGG GG GG G G G GGG Sbjct: 95 GSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GG GG GG G G G G GGG G Sbjct: 150 GGGRGRGGGEGGWGGRGGNGGGRG-GGEGGGGRGRGTGGGSRG 191 Score = 28.3 bits (60), Expect = 9.3 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 919 GXXGGGXXGG-GXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 G G G GG G GG GG G G G G GGG G Sbjct: 137 GGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGG-GEGGGGRG 182 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 3/49 (6%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXX---PPPXXPPPXXP 920 P PP P P P PP P PPP PPP P Sbjct: 237 PMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPP 285 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXP---XPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PP P P P PP PP PP PPP P Sbjct: 157 PISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPP 212 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 783 PXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PP P P PP P PPP P P P Sbjct: 185 PPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTP 230 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPX-PXXPPXXXXXXXPPXXPPPXXPPPXXP 920 PP P P P PP PP PP PPP P Sbjct: 156 PPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPP 199 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 PPP P P P P P PP P P P P Sbjct: 194 PPPIPPIDP-PRTQPPPIPPIDPPRTQPPPIFPQPTTPAP 232 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 PPP P P P PP PP P P PP P Sbjct: 122 PPPPPTG----TLPPPPVTPPPGPETPPPPDTPAPPVPPTEAP 160 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 2/45 (4%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXP--PXXPPPXXPPPXXP 920 PPP P P P P PP P P PP P P Sbjct: 456 PPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPP 500 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXG-XGGGXXG 782 G GGG GGG GG GG G G G G GGG G Sbjct: 333 GDHGGGDPGGGDPGG---GDPGGGDPGGGDPGGGDHGGGDHGGGDHG 376 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXG-XGGGXXG 782 G GGG GGG GG GG G G G G GGG G Sbjct: 343 GDPGGGDPGGGDPGG---GDPGGGDHGGGDHGGGDHGDGDHGGGDHG 386 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXG-XGGGXXG 782 G GGG GGG GG GG G G G G GGG G Sbjct: 353 GDPGGGDPGGGDHGG---GDHGGGDHGDGDHGGGDHGGGDHGGGDHG 396 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGX-GXXXGXXXXXGXGGG 791 G GG GGG GG GG G G G G GGG Sbjct: 154 GGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGG 197 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GGG GG GG G G G GGG G Sbjct: 53 GGGATGGGATGGGGGATGGGG----GATGGHGGATGGGGGATG 91 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GG GGG GG GG G G G GG Sbjct: 115 GEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGG 157 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPP 908 P P PP P P PP PP PPP P Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 907 GGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GG GGG GG G G G G GGG G Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGG 794 G GGG GGG G GG G G G GG Sbjct: 101 GRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 GGG GG GG G G G G G GGG Sbjct: 142 GGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGG 181 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 910 GGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGGXXG 782 GGG GGG G G G G G G G G G Sbjct: 165 GGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGG 207 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 834 PXPXXPPXXXXXXXPPXXPPPXXPPP 911 P P PP PP PPP PP Sbjct: 197 PPPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 798 PXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 P P P P P PP PP PP PPP Sbjct: 188 PSPMAGMPPPPPPPP--PPGFPGGAPPPPPPPFGAPPP 223 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 29.1 bits (62), Expect = 5.3 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 762 PXXXXXXPXXPPPX--PXXXXXPXXXPXPXXPPXXXXXXX-PPXXPPPXXPPP 911 P P PPP P P P PP PP PP PPP Sbjct: 2164 PSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 834 PXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P PP PP PPP PPP P Sbjct: 862 PRPRRPPPP-----PPPPPPPPPPPPPPP 885 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 PPP P P P PP PP P P P P Sbjct: 1253 PPPPPGMRPMPPQPPF-MPPPPRMQPPGPPGPPGPPGPQP 1291 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPP 908 PPP P P P P PP PPP PP Sbjct: 357 PPPPPGRAPQPLGGPPP--PPPGRRPPSGKINPPPPPPP 393 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 PPP P P P PP PP PP PP P Sbjct: 554 PPPPPPGVDIP-----PPLPPSEDPKPPPPPPEPPEECPPPPP 591 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPP 908 PPP P P P P PP PPP PP Sbjct: 269 PPPPPGRAPQPLGGPPP--PPPGRRPPSGKINPPPPPPP 305 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 2/45 (4%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXP--PXXPPPXXPPPXXP 920 PPP P P P PP P P PP PP P Sbjct: 31 PPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 919 GXXGGGXXGGGXXGGXXXXXXXGGXXGXGXXXGXXXXXGXGGG 791 G GG GGG G GG G G G GGG Sbjct: 223 GVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGG 265 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 792 PPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPP 896 PPP P P P P PP PPP Sbjct: 50 PPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/50 (28%), Positives = 14/50 (28%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 P P P P P P PP PPP PPP Sbjct: 1029 PKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPP 1078 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/48 (31%), Positives = 15/48 (31%), Gaps = 2/48 (4%) Frame = +3 Query: 783 PXXPP--PXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P PP P P P P PP P PPP P P Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPP 1087 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/50 (28%), Positives = 14/50 (28%) Frame = +3 Query: 762 PXXXXXXPXXPPPXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPP 911 P P PP P P P P P PPP P P Sbjct: 1062 PSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKP 1111 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 28.3 bits (60), Expect = 9.3 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 5/51 (9%) Frame = +3 Query: 783 PXXPPPX--PXXXXXPXXXPXPXX---PPXXXXXXXPPXXPPPXXPPPXXP 920 P PPP P P P P PP PP PPP P P Sbjct: 380 PHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPPIGVPNRP 430 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 798 PXPXXXXXPXXXPXPXXPPXXXXXXXPPXXPPPXXPPPXXP 920 P P P P PP P PPP PP P Sbjct: 394 PGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGP 434 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,495,265 Number of Sequences: 59808 Number of extensions: 171465 Number of successful extensions: 2542 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1504 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2693287426 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -