BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_I18 (918 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0487 + 16471538-16471540,16471694-16471795,16471880-164719... 120 2e-27 02_03_0220 + 16545571-16545573,16545717-16545818,16545980-165460... 47 2e-05 04_03_0796 + 19721379-19721381,19721479-19721580,19722558-19722590 46 6e-05 04_04_0303 + 24269467-24270741 29 5.2 >04_03_0487 + 16471538-16471540,16471694-16471795,16471880-16471908, 16472619-16472745 Length = 86 Score = 120 bits (289), Expect = 2e-27 Identities = 53/78 (67%), Positives = 60/78 (76%) Frame = +2 Query: 89 IXLLHPSPASXRXXXKLKRLVPHPNSYFMDVKCPGCYKXTTVFSHAQXVVVCAGCSTILC 268 I LL+P + K KRLV PNS+FMDVKC GC+ TTVFSH+Q VVVC GC T+LC Sbjct: 7 IDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPGCQTVLC 66 Query: 269 QPTGGRARLTEGCSFRRK 322 QPTGG+ARLTEGCSFRRK Sbjct: 67 QPTGGKARLTEGCSFRRK 84 >02_03_0220 + 16545571-16545573,16545717-16545818,16545980-16546008, 16549421-16553036 Length = 1249 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/46 (47%), Positives = 27/46 (58%) Frame = +2 Query: 89 IXLLHPSPASXRXXXKLKRLVPHPNSYFMDVKCPGCYKXTTVFSHA 226 I LL+P + K KRLV PNS+FMDVKC GC+ + F A Sbjct: 7 IDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNMSVRFDIA 52 >04_03_0796 + 19721379-19721381,19721479-19721580,19722558-19722590 Length = 45 Score = 45.6 bits (103), Expect = 6e-05 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +2 Query: 89 IXLLHPSPASXRXXXKLKRLVPHPNSYFMDVKCPGCY 199 I LL+P + K KRLV PNS+FMDVKC GC+ Sbjct: 7 IDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCF 43 >04_04_0303 + 24269467-24270741 Length = 424 Score = 29.1 bits (62), Expect = 5.2 Identities = 21/68 (30%), Positives = 31/68 (45%) Frame = +2 Query: 86 AIXLLHPSPASXRXXXKLKRLVPHPNSYFMDVKCPGCYKXTTVFSHAQXVVVCAGCSTIL 265 A+ LLHP L ++PH S +D CP Y+ + S A+ V C+++ Sbjct: 148 AVRLLHPFTGDTAELPPLGTVLPHLGSRLLD--CPAPYR---IRSLARVV-----CASVS 197 Query: 266 CQPTGGRA 289 C TG A Sbjct: 198 CSATGAGA 205 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,968,367 Number of Sequences: 37544 Number of extensions: 215503 Number of successful extensions: 320 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 320 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2612387020 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -