BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_I18 (918 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF101312-3|AAC69219.1| 83|Caenorhabditis elegans Ribosomal pro... 134 6e-32 >AF101312-3|AAC69219.1| 83|Caenorhabditis elegans Ribosomal protein, small subunitprotein 27 protein. Length = 83 Score = 134 bits (325), Expect = 6e-32 Identities = 58/82 (70%), Positives = 66/82 (80%) Frame = +2 Query: 80 PLAIXLLHPSPASXRXXXKLKRLVPHPNSYFMDVKCPGCYKXTTVFSHAQXVVVCAGCST 259 PLA+ LLHP P KLKRLV HPNSYFMDVKC GC+K +TVFSHA VVVC GC+T Sbjct: 2 PLAVDLLHPEPQREIRCHKLKRLVQHPNSYFMDVKCSGCFKISTVFSHATTVVVCVGCNT 61 Query: 260 ILCQPTGGRARLTEGCSFRRKQ 325 +LCQPT G+A+LTEGCSFR+KQ Sbjct: 62 VLCQPTRGKAKLTEGCSFRKKQ 83 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,104,591 Number of Sequences: 27780 Number of extensions: 178419 Number of successful extensions: 291 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 291 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2349764032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -