BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_I17 (893 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 29 0.25 DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 25 4.1 AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 24 5.4 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 24 5.4 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 24 5.4 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 5.4 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 23 9.5 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 23 9.5 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 28.7 bits (61), Expect = 0.25 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -2 Query: 154 ACCEYVSLNAYWATCVVFIM 95 ACC Y+ +++ATC +F + Sbjct: 177 ACCMYIPFTSFYATCTLFAL 196 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 24.6 bits (51), Expect = 4.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 335 CFCIVNCLRQACSGGLLW 282 CFC N +R+A G +W Sbjct: 72 CFCKKNYVRRAIGGSCIW 89 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 24.2 bits (50), Expect = 5.4 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 197 HHRSRPVHV*RTPD 238 HHRSRP+ V + PD Sbjct: 275 HHRSRPLAVEKQPD 288 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 24.2 bits (50), Expect = 5.4 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 197 HHRSRPVHV*RTPD 238 HHRSRP+ V + PD Sbjct: 251 HHRSRPLAVEKQPD 264 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 24.2 bits (50), Expect = 5.4 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 197 HHRSRPVHV*RTPD 238 HHRSRP+ V + PD Sbjct: 248 HHRSRPLAVEKQPD 261 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 24.2 bits (50), Expect = 5.4 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -3 Query: 483 LHFILFKHNPLRIYTL*IFTERTSLN*NDLNKDRLPYVDAF 361 L + +HN L I F+ +L+ L+ ++L Y+DA+ Sbjct: 394 LQILNLRHNQLEIIAADTFSPMNNLHTLLLSHNKLKYLDAY 434 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 87 RVIFETLRMFPPVPMIARKINEDVQLASK 115 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 87 RVIFETLRMFPPVPMIARKINEDVQLASK 115 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 87 RVIFETLRMFPPVPMIARKINEDVQLASK 115 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 87 RVIFETLRMFPPVPMIARKINEDVQLASK 115 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 90 RVIFETLRMFPPVPMIARKINEDVQLASK 118 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 90 RVIFETLRMFPPVPMIARKINEDVQLASK 118 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 99 RVIFETLRMFPPVPMIARKINEDVQLASK 127 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 99 RVIFETLRMFPPVPMIARKINEDVQLASK 127 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 101 RVIFETLRMFPPVPMIARKINEDVQLASK 129 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 101 RVIFETLRMFPPVPMIARKINEDVQLASK 129 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 87 RVIFETLRMFPPVPMIARKINEDVQLASK 115 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 87 RVIFETLRMFPPVPMIARKINEDVQLASK 115 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 101 RVIFETLRMFPPVPMIARKINEDVQLASK 129 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 101 RVIFETLRMFPPVPMIARKINEDVQLASK 129 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 99 RVIFETLRMFPPVPMIARKINEDVQLASK 127 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 99 RVIFETLRMFPPVPMIARKINEDVQLASK 127 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 101 RVIFETLRMFPPVPMIARKINEDVQLASK 129 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 101 RVIFETLRMFPPVPMIARKINEDVQLASK 129 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 99 RVIFETLRMFPPVPMIARKINEDVQLASK 127 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 99 RVIFETLRMFPPVPMIARKINEDVQLASK 127 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 86 RVIFETLRMFPPVPMIARKINEDVQLASK 114 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 86 RVIFETLRMFPPVPMIARKINEDVQLASK 114 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 99 RVIFETLRMFPPVPMIARKINEDVQLASK 127 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 99 RVIFETLRMFPPVPMIARKINEDVQLASK 127 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 99 RVIFETLRMFPPVPMIARKINEDVQLASK 127 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 99 RVIFETLRMFPPVPMIARKINEDVQLASK 127 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 100 RVIFETLRMFPPVPMIARKINEDVQLASK 128 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 100 RVIFETLRMFPPVPMIARKINEDVQLASK 128 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 98 RVIFETLRMFPPVPMIARKINEDVQLASK 126 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 244 RIIWRTLNVDRPRPMVARSRADRVIIFSR 158 R+I+ TL + P PM+AR + V + S+ Sbjct: 62 RVIFETLRMFPPVPMIARKINEDVQLASK 90 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 755,373 Number of Sequences: 2352 Number of extensions: 13658 Number of successful extensions: 123 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96334083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -