BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_I16 (878 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 6.5 AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 22 6.5 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 8.6 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.2 bits (45), Expect = 6.5 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -2 Query: 799 NCXRASGPPAALPPHPKNIGKK 734 +C S PP PP K G++ Sbjct: 388 SCVACSPPPRQTPPSRKESGRR 409 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 22.2 bits (45), Expect = 6.5 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 391 LIVAARPLPIPATYRNKKTKSITLSNQRTRSSAPLKRPSWL 513 + AA + +Y + IT+ N+R R L +PS+L Sbjct: 2 MATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFL 42 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 8.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 393 DRRRQTLADTSYVPQQENEVYYP 461 D QT++ T+ V Q+E E Y P Sbjct: 338 DLTTQTVSTTADVLQEEEEEYSP 360 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,965 Number of Sequences: 438 Number of extensions: 5604 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28523595 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -