BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_I16 (878 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66060.1 68418.m08323 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 3.1 At5g16220.1 68418.m01895 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.1 At1g20270.1 68414.m02531 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 4.1 At3g13060.2 68416.m01628 expressed protein contains Pfam profile... 29 5.4 At3g13060.1 68416.m01627 expressed protein contains Pfam profile... 29 5.4 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 29 5.4 At3g57170.1 68416.m06365 N-acetylglucosaminyl transferase compon... 28 7.2 >At5g66060.1 68418.m08323 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to prolyl 4-hydroxylase, alpha subunit, from Rattus norvegicus [GI:474940], Mus musculus [SP|Q60715], Homo sapiens [GI:18073925]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 267 Score = 29.5 bits (63), Expect = 3.1 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +1 Query: 358 HRRLQRARCTYLIVAARPLPIPATYRNKKTKSITLSNQRTRSSAPLKR 501 H L + C YLI A+P +T ++KT T S RT S L R Sbjct: 91 HNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSGTFLAR 138 >At5g16220.1 68418.m01895 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein hypothetical proteins - Arabidopsis thaliana contains Pfam profile PF00564: PB1 domain Length = 476 Score = 29.5 bits (63), Expect = 3.1 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +3 Query: 321 GMAAFMYR-QPEAAQAPSTGQVYIPDRRRQTLADTSYVPQQENEVYYPQQPE-NPIF 485 G FM + Q + Q TGQ YI TL T+Y N VYY + P+ PI+ Sbjct: 317 GYPPFMNQAQQQHIQVIYTGQPYITGNSPMTLPATAY--HHTNHVYYQRPPQPYPIY 371 >At1g20270.1 68414.m02531 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to prolyl 4-hydroxylase, alpha subunit, from Gallus gallus [GI:212530], Rattus norvegicus [GI:474940], Mus musculus [SP|Q60715]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 287 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 358 HRRLQRARCTYLIVAARPLPIPATYRNKKTKSITLSNQRTRSSAPLKR 501 H L + C YLI A+P + +T + +T S RT S L+R Sbjct: 89 HNFLSKEECEYLISLAKPHMVKSTVVDSETGKSKDSRVRTSSGTFLRR 136 >At3g13060.2 68416.m01628 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 634 Score = 28.7 bits (61), Expect = 5.4 Identities = 29/92 (31%), Positives = 38/92 (41%), Gaps = 5/92 (5%) Frame = +3 Query: 213 YGNVDSLSYGS--GDSNRGGLVMSRYYNPYYNPRAVGGGMAAFMYRQPEAAQAPSTGQVY 386 Y NV+ L S G + LV Y YNP+ G + P A+ PS GQ+Y Sbjct: 100 YVNVEGLDITSPVGFNENASLVYQTGYG--YNPQMPYGPYS------PAASPLPSEGQLY 151 Query: 387 IPDRRRQTLADTSY---VPQQENEVYYPQQPE 473 P + + A Y VP + P QPE Sbjct: 152 SPQQFPFSGASPYYQQVVPPSMQYITSPTQPE 183 >At3g13060.1 68416.m01627 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 551 Score = 28.7 bits (61), Expect = 5.4 Identities = 29/92 (31%), Positives = 38/92 (41%), Gaps = 5/92 (5%) Frame = +3 Query: 213 YGNVDSLSYGS--GDSNRGGLVMSRYYNPYYNPRAVGGGMAAFMYRQPEAAQAPSTGQVY 386 Y NV+ L S G + LV Y YNP+ G + P A+ PS GQ+Y Sbjct: 100 YVNVEGLDITSPVGFNENASLVYQTGYG--YNPQMPYGPYS------PAASPLPSEGQLY 151 Query: 387 IPDRRRQTLADTSY---VPQQENEVYYPQQPE 473 P + + A Y VP + P QPE Sbjct: 152 SPQQFPFSGASPYYQQVVPPSMQYITSPTQPE 183 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 28.7 bits (61), Expect = 5.4 Identities = 22/61 (36%), Positives = 25/61 (40%), Gaps = 4/61 (6%) Frame = +3 Query: 201 YNPYYGNVDSLSYGSGDSNRGGLVMSRYYN----PYYNPRAVGGGMAAFMYRQPEAAQAP 368 Y PY G+ YG G + G Y N PY NP G G + R AQAP Sbjct: 238 YPPYGGSGYGTGYGYGSNGVGYGGFGGYGNPAGAPYGNPSVPGAGFGSGP-RSSWGAQAP 296 Query: 369 S 371 S Sbjct: 297 S 297 >At3g57170.1 68416.m06365 N-acetylglucosaminyl transferase component family protein / Gpi1 family protein similar to SP|O14357 N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein gpi1 {Schizosaccharomyces pombe}; contains Pfam profile PF05024: N-acetylglucosaminyl transferase component (Gpi1) Length = 560 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 451 SITLSNQRTRSSAPLKRPSWLTPL 522 S++ SN ++ APLK+P W+ L Sbjct: 49 SLSFSNSSPQTKAPLKKPKWVDDL 72 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,021,145 Number of Sequences: 28952 Number of extensions: 354366 Number of successful extensions: 962 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 962 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2067932800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -