BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_I10 (885 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. 26 1.3 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 26 1.8 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 5.4 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 24 7.1 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 7.1 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 23 9.4 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 23 9.4 >DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. Length = 75 Score = 26.2 bits (55), Expect = 1.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 103 YIDEFGQTTTRMQ*KKCFICEICDAIALFVT 195 ++D GQ T R + KCF C + + L T Sbjct: 13 FVDVGGQRTQRQKWTKCFDCSVTSILFLVST 43 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 25.8 bits (54), Expect = 1.8 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 Query: 465 SHVLSCVIPLILWITVLPPLSELIPLAA 382 S +LS V+ L+L +LPP S ++PL A Sbjct: 269 SILLSLVVFLLLVSKILPPTSLVLPLIA 296 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.2 bits (50), Expect = 5.4 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -2 Query: 713 RKRHASRREKXGQVSGKRQGRKQESARGS 627 RKR ++ + Q G + RK+++ RGS Sbjct: 937 RKRKGEKKPRKSQGGGGSRKRKEKARRGS 965 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 23.8 bits (49), Expect = 7.1 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 496 YGSWPFAGLLLTCSFLRYPPDSVDN 422 +GSW + G ++ L+ PDS DN Sbjct: 166 FGSWTYDGYMVDLRHLQQTPDS-DN 189 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 7.1 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 183 SNSITNFTNKAFFSLHS 133 SN+I NFT KAF L S Sbjct: 520 SNNIENFTRKAFKDLPS 536 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 23.4 bits (48), Expect = 9.4 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 690 PSGSVALSHSSRCRYLS 740 P+GS +S S RCRY S Sbjct: 481 PAGSRVVSVSLRCRYCS 497 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 23.4 bits (48), Expect = 9.4 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 690 PSGSVALSHSSRCRYLS 740 P+GS +S S RCRY S Sbjct: 481 PAGSRVVSVSLRCRYCS 497 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 792,049 Number of Sequences: 2352 Number of extensions: 14644 Number of successful extensions: 22 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95093730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -