BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_I08 (897 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 26 0.46 AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 26 0.46 AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 25 1.1 AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esteras... 25 1.1 AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esteras... 25 1.1 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 25.8 bits (54), Expect = 0.46 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +1 Query: 553 VQQPAPKSVARPITEDEKXFKAYQYLRGARSIAKLVGIRAKRLKDAAENPDDVTK 717 +Q+P P +PIT+ E ++ L+ I+KLV K E P D K Sbjct: 326 LQRPKP---FKPITDFELAVPSFLKLQRGSDISKLVAKNIKEFYYGNEEPTDKNK 377 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 25.8 bits (54), Expect = 0.46 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +1 Query: 553 VQQPAPKSVARPITEDEKXFKAYQYLRGARSIAKLVGIRAKRLKDAAENPDDVTK 717 +Q+P P +PIT+ E ++ L+ I+KLV K E P D K Sbjct: 326 LQRPKP---FKPITDFELAVPSFLKLQRGSDISKLVAKNIKEFYYGNEEPTDKNK 377 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 24.6 bits (51), Expect = 1.1 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +1 Query: 553 VQQPAPKSVARPITEDEKXFKAYQYLRGARSIAKLVGIRAKRLKDAAENPDDVTK 717 +Q+P P +PIT+ E + L+ I+KLV K E P D K Sbjct: 326 LQRPKP---FKPITDFELAVPNFLKLQRGSDISKLVAKNIKEFYYGNEEPTDKNK 377 >AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 24.6 bits (51), Expect = 1.1 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +1 Query: 553 VQQPAPKSVARPITEDEKXFKAYQYLRGARSIAKLVGIRAKRLKDAAENPDDVTK 717 +Q+P P +PIT+ E + L+ I+KLV K E P D K Sbjct: 326 LQRPKP---FKPITDFELAVPNFLKLQRGSDISKLVAKNIKEFYYGNEEPTDKNK 377 >AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esterase protein. Length = 509 Score = 24.6 bits (51), Expect = 1.1 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +1 Query: 553 VQQPAPKSVARPITEDEKXFKAYQYLRGARSIAKLVGIRAKRLKDAAENPDDVTK 717 +Q+P P +PIT+ E + L+ I+KLV K E P D K Sbjct: 325 LQRPKP---FKPITDFELAVPNFLKLQRGSDISKLVAKNIKEFYYGNEEPTDKNK 376 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,876 Number of Sequences: 336 Number of extensions: 2380 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24927353 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -