BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_I03 (861 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC18E5.06 |rps21||40S ribosomal protein S21|Schizosaccharomyce... 56 5e-09 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 29 0.64 SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces... 28 1.5 SPBC25H2.02 |ths1||threonine-tRNA ligase Ths1 |Schizosaccharomyc... 28 1.5 >SPBC18E5.06 |rps21||40S ribosomal protein S21|Schizosaccharomyces pombe|chr 2|||Manual Length = 87 Score = 56.4 bits (130), Expect = 5e-09 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 94 MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 186 M+N+AG+ VDLY PRKCSA+NR+I AKDHAS Sbjct: 1 MENEAGQLVDLYVPRKCSATNRIIQAKDHAS 31 Score = 41.9 bits (94), Expect = 1e-04 Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +2 Query: 191 QLVIADVDPATGRAADTSKM-YVVCGAIRRMGESDDCIVRLTKKDGIL 331 Q+ + VD A GR K Y + G +R GESDDCI RLT +DG+L Sbjct: 33 QINVCAVD-AEGRQIPGEKTTYAISGFVRSKGESDDCINRLTTQDGLL 79 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 29.5 bits (63), Expect = 0.64 Identities = 16/55 (29%), Positives = 18/55 (32%) Frame = +3 Query: 669 LMNPPXPGXXGLXXGPLPLLXPDXXPPPXXCXXRXXPPXXGXXXXXPXXXPXXPP 833 L +PP P + P P P P P PP G P P PP Sbjct: 729 LKSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 >SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1639 Score = 28.3 bits (60), Expect = 1.5 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 135 RAVQVNEFTGVVLHFICTSTRVH 67 RAV + + TG VLHF T T VH Sbjct: 808 RAVPLRDCTGSVLHFFGTMTDVH 830 >SPBC25H2.02 |ths1||threonine-tRNA ligase Ths1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 703 Score = 28.3 bits (60), Expect = 1.5 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -2 Query: 176 SLAWMRRLLAEHFLGQYKSTNSPASFCILYVRPHGYTGIDR 54 SL M +L EH+ G++ SP CI+ V Y D+ Sbjct: 575 SLERMIAILTEHYAGKWPFWMSPRQVCIIPVSAAAYNYADK 615 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,327,302 Number of Sequences: 5004 Number of extensions: 36828 Number of successful extensions: 82 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 428468660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -