Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP02_F_H24
         (896 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB158503-1|BAD69710.1|  151|Homo sapiens splice variant of four ...    37   0.086

>AB158503-1|BAD69710.1|  151|Homo sapiens splice variant of four and
           a half LIM domain protein 2 protein.
          Length = 151

 Score = 37.1 bits (82), Expect = 0.086
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = +2

Query: 479 AG*EKGSTEACSSTLLLPRASTEPTARVSTCPLLTRSIPTSSLTAMS 619
           AG    S+   +S+ L PR S+  T R+S CP +  ++P S+ +A S
Sbjct: 63  AGMRPASSATAASSQLEPRVSSPKTIRISVCPAMRNNMPCSAFSAKS 109


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 105,871,499
Number of Sequences: 237096
Number of extensions: 1940316
Number of successful extensions: 3910
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3805
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3910
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11548247776
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)