BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP02_F_H24
(896 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB158503-1|BAD69710.1| 151|Homo sapiens splice variant of four ... 37 0.086
>AB158503-1|BAD69710.1| 151|Homo sapiens splice variant of four and
a half LIM domain protein 2 protein.
Length = 151
Score = 37.1 bits (82), Expect = 0.086
Identities = 17/47 (36%), Positives = 27/47 (57%)
Frame = +2
Query: 479 AG*EKGSTEACSSTLLLPRASTEPTARVSTCPLLTRSIPTSSLTAMS 619
AG S+ +S+ L PR S+ T R+S CP + ++P S+ +A S
Sbjct: 63 AGMRPASSATAASSQLEPRVSSPKTIRISVCPAMRNNMPCSAFSAKS 109
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 105,871,499
Number of Sequences: 237096
Number of extensions: 1940316
Number of successful extensions: 3910
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3805
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3910
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11548247776
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -