BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H20 (905 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 25 0.81 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 7.6 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 25.0 bits (52), Expect = 0.81 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 665 TLTSLELAMSLAVLMIQTFFTILLLWGHDLYGXENY 772 T+T + L L ++ F I+ L+ H YG EN+ Sbjct: 17 TVTPVSLRFKLYTIV--HIFIIIALYAHSSYGRENF 50 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 7.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 388 LDCPEXKENLATRTAKTPNECCWISRVSSTVL 293 ++CP+ + K P ECC I V++T L Sbjct: 708 MECPQVTCPDNMKLEKVPGECCAIC-VNATSL 738 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,730 Number of Sequences: 336 Number of extensions: 2592 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25237652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -