BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H20 (905 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0130 + 1040696-1041049,1042135-1042275,1042422-1042673,104... 79 5e-15 >08_01_0130 + 1040696-1041049,1042135-1042275,1042422-1042673, 1043797-1043904,1044289-1044593,1044720-1044841, 1044979-1045225,1045308-1045365,1045414-1045530, 1045718-1045753,1046492-1046554,1046958-1047047, 1047241-1047399,1047475-1047596,1048145-1048217, 1048307-1048375 Length = 771 Score = 79.0 bits (186), Expect = 5e-15 Identities = 43/129 (33%), Positives = 67/129 (51%) Frame = +1 Query: 424 DFINNCNGEQVRFATDLYADLCHLLTNHLVEIKQPIRGLEILKKAIRKIQLFDSQLTSIH 603 DF+ +C+ EQ+R A D + +C + N ++++ PIRG+ L+ AIRKIQ +LT IH Sbjct: 411 DFLVSCSAEQIRLAPDKFLSVCRVFKNEVMQLNAPIRGIAPLRAAIRKIQTSSEELTPIH 470 Query: 604 ADLCQLCLLSKCMXPAVEFLDTDVTGIGXELGGINDSNIFYYIITMGA*FIRX*KL**SF 783 AD LCLL+K + L+ D+ + ++F Y G +I K + Sbjct: 471 ADYLLLCLLAKQYKAGLSVLEDDILEVD------QPKDLFLYCYYGGMIYIGLKKFTIAL 524 Query: 784 VFL*SCXXC 810 FL +C C Sbjct: 525 DFLHNCLQC 533 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,686,729 Number of Sequences: 37544 Number of extensions: 243988 Number of successful extensions: 398 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2565528060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -