BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H20 (905 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 2.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.8 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 23.4 bits (48), Expect = 2.9 Identities = 12/41 (29%), Positives = 16/41 (39%) Frame = +1 Query: 352 WWXXXXXXXXXXEVDRSTMYQQFHDFINNCNGEQVRFATDL 474 WW + RS +QF D + CN VR D+ Sbjct: 76 WWERYQPISYKW-ITRSGTREQFIDMVARCNKAGVRIYVDV 115 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 3.8 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +1 Query: 526 PIRGLEILKKAIRKIQLFDSQLTSIHADLCQLCLLSKCMXPAVEFL 663 P+R LEIL+ + ++ F +++A L +L L S +FL Sbjct: 888 PLRSLEILRLSGNRLVTFPVWQVTLNARLVELSLGSNPWSCRCKFL 933 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,310 Number of Sequences: 438 Number of extensions: 2558 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29388177 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -