BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H20 (905 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14250.1 68418.m01665 COP9 signalosome complex subunit 3 / CS... 72 6e-13 >At5g14250.1 68418.m01665 COP9 signalosome complex subunit 3 / CSN complex subunit 3 (CSN3) / FUSCA protein (FUS11) CSN3, FUS11; identical to COP9 signalosome subunit 3 GI:14388969 [Arabidopsis thaliana]; identical to cDNA CSN complex subunit 3 (CSN3) GI:18056656; contains Pfam profile PF01399: PCI domain Length = 429 Score = 71.7 bits (168), Expect = 6e-13 Identities = 30/86 (34%), Positives = 52/86 (60%) Frame = +1 Query: 427 FINNCNGEQVRFATDLYADLCHLLTNHLVEIKQPIRGLEILKKAIRKIQLFDSQLTSIHA 606 FIN+C+ Q+R A+ + LC +L +H++ + P+RG+ L A++K+Q+ +LT++H Sbjct: 89 FINSCDAGQIRLASYKFVSLCKILKDHVIALGDPLRGVGPLLNAVQKLQVSSKRLTALHP 148 Query: 607 DLCQLCLLSKCMXPAVEFLDTDVTGI 684 D+ QLCL +K L D+ I Sbjct: 149 DVLQLCLQAKSYKSGFSILSDDIVEI 174 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,883,443 Number of Sequences: 28952 Number of extensions: 206187 Number of successful extensions: 405 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2139598560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -