Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP02_F_H13
         (1164 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_07_0031 - 27183252-27183317,27183542-27184282                       26   8.4  

>05_07_0031 - 27183252-27183317,27183542-27184282
          Length = 268

 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 14/50 (28%), Positives = 16/50 (32%)
 Frame = +2

Query: 803 PPPXPXPTXXLXTXXPAXXGRAXPXXSLRHPASHPGRARLXARRXXEPXP 952
           PPP P P   L    P   G A P    +     P  +   A     P P
Sbjct: 150 PPPPPPPPPLLPMAQPQADGAARPWNLRQRTRRRPAASMSWAAAAAVPVP 199



 Score = 21.0 bits (42), Expect(2) = 8.4
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = +2

Query: 785 RAPXXXPPPXPXP 823
           R P   PPP P P
Sbjct: 111 RVPQPSPPPPPPP 123


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,738,430
Number of Sequences: 37544
Number of extensions: 188027
Number of successful extensions: 423
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 358
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 414
length of database: 14,793,348
effective HSP length: 83
effective length of database: 11,677,196
effective search space used: 3549867584
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)