BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H13 (1164 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 25 6.4 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 25.4 bits (53), Expect(2) = 6.4 Identities = 11/35 (31%), Positives = 12/35 (34%) Frame = +2 Query: 803 PPPXPXPTXXLXTXXPAXXGRAXPXXSLRHPASHP 907 PPP P PT T P + P P P Sbjct: 523 PPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 21.8 bits (44), Expect(2) = 6.4 Identities = 8/22 (36%), Positives = 9/22 (40%) Frame = +2 Query: 758 PHPXXXXXHRAPXXXPPPXPXP 823 P P + P PPP P P Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPP 508 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,426,869 Number of Sequences: 28952 Number of extensions: 124876 Number of successful extensions: 192 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 185 length of database: 12,070,560 effective HSP length: 82 effective length of database: 9,696,496 effective search space used: 2957431280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -