BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H12 (922 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 25 2.4 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 5.6 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 24 7.5 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 23 9.8 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 23 9.8 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 23 9.8 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 23 9.8 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 23 9.8 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 23 9.8 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 25.4 bits (53), Expect = 2.4 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -2 Query: 483 RTQIIFRTGRDRSIASLYFPANENDYTSLVQTLLMHLRGS 364 R + + G+ A L A EN+ Q +L HLRGS Sbjct: 353 RLEKAIKVGKRAEFAKLIDIAEENELGVGYQVVLSHLRGS 392 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.2 bits (50), Expect = 5.6 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +2 Query: 224 CPKNTEHRA-RHAGKCACCPACVTLLGEGA 310 C + E++ RH G C CPAC L+ + A Sbjct: 1016 CDRCKENKYDRHQG-CLDCPACYNLVQDAA 1044 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 23.8 bits (49), Expect = 7.5 Identities = 19/64 (29%), Positives = 26/64 (40%) Frame = +2 Query: 125 IMLVACVASAAYGALVCGTDYCEKNPCIQPPLVCPKNTEHRARHAGKCACCPACVTLLGE 304 I+LVA VA A+ DY ++ C+ +RA + A CP L Sbjct: 4 IVLVALVAGCLLVAVAAQADYIQQEQCV--------TASNRAGYCTTKAECPDQEQLDLR 55 Query: 305 GATC 316 ATC Sbjct: 56 AATC 59 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.4 bits (48), Expect = 9.8 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 107 MKTLIFIMLVACVASAAYGALV-CGTDYCEKNPCIQPPLVCP 229 + TL + LVA V S ++G L+ C + + PP+V P Sbjct: 552 LTTLFIVTLVANV-STSFGYLISCASSSISMALSVGPPVVIP 592 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.4 bits (48), Expect = 9.8 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 107 MKTLIFIMLVACVASAAYGALV-CGTDYCEKNPCIQPPLVCP 229 + TL + LVA V S ++G L+ C + + PP+V P Sbjct: 552 LTTLFIVTLVANV-STSFGYLISCASSSISMALSVGPPVVIP 592 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 23.4 bits (48), Expect = 9.8 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 107 MKTLIFIMLVACVASAAYGALV-CGTDYCEKNPCIQPPLVCP 229 + TL + LVA V S ++G L+ C + + PP+V P Sbjct: 530 LTTLFIVTLVANV-STSFGYLISCASSSISMALSVGPPVVIP 570 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.4 bits (48), Expect = 9.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 409 LHKLSANSFDAFERLLTHSG 350 LH LSA S D F+R + SG Sbjct: 368 LHLLSALSRDLFQRAILQSG 387 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.4 bits (48), Expect = 9.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 409 LHKLSANSFDAFERLLTHSG 350 LH LSA S D F+R + SG Sbjct: 368 LHLLSALSRDLFQRAILQSG 387 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 23.4 bits (48), Expect = 9.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 409 LHKLSANSFDAFERLLTHSG 350 LH LSA S D F+R + SG Sbjct: 254 LHLLSALSRDLFQRAILQSG 273 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 733,029 Number of Sequences: 2352 Number of extensions: 13310 Number of successful extensions: 22 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 100055142 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -