BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H12 (922 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 2.2 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 6.8 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 22 9.0 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 9.0 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 2.2 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 423 QENISLQYFYHDL-FEI*FVYGIKLIIICTV 512 ++N+ + Y D + I F Y I LI++CTV Sbjct: 802 EDNLLVCNSYVDASYMIAFAYPIMLIVVCTV 832 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 22.2 bits (45), Expect = 6.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 308 HLHQVKLHKRDNKHTFQRVWRDAQ 237 ++ +VK K +KH Q W D + Sbjct: 325 YIPKVKNKKAGSKHLLQNTWLDPE 348 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.8 bits (44), Expect = 9.0 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +2 Query: 227 PKNTEHRARHAGKCACCPACVTLLGEGATCKIYSKELGETPSAV 358 P N A A KCA L E A C+ K + +P V Sbjct: 153 PMNRNRPAYLASKCALTTLTDCLRSELAQCESNIKVISISPDLV 196 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.8 bits (44), Expect = 9.0 Identities = 7/27 (25%), Positives = 16/27 (59%) Frame = +2 Query: 89 VFKNFKMKTLIFIMLVACVASAAYGAL 169 +FK FK + +++++ AC+ + L Sbjct: 431 LFKTFKDRKYLYMLMEACLGGELWTVL 457 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,476 Number of Sequences: 438 Number of extensions: 3663 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29992872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -