BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H11 (886 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_55864| Best HMM Match : Sad1_UNC (HMM E-Value=6.9e-25) 29 6.6 >SB_36386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 472 RFHNQSLETKDLHSAMVQTSRLNSSVGSSLPCG 570 R+ +S ET DLH V TS SSL CG Sbjct: 49 RWQTKSAETPDLHEGRVGTSPPTGPPTSSLHCG 81 >SB_55864| Best HMM Match : Sad1_UNC (HMM E-Value=6.9e-25) Length = 526 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 394 GSTF*QCAVRCRPRA-CSSTPWCSVSC 317 G T + RP+A CS +PWC ++C Sbjct: 270 GDTNNNVTIAARPKAWCSCSPWCVLTC 296 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,137,777 Number of Sequences: 59808 Number of extensions: 415545 Number of successful extensions: 1107 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1015 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1106 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2526446612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -