BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H09 (917 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC613.05c |rpl35||60S ribosomal protein L35|Schizosaccharomyce... 59 1e-09 >SPCC613.05c |rpl35||60S ribosomal protein L35|Schizosaccharomyces pombe|chr 3|||Manual Length = 122 Score = 58.8 bits (136), Expect = 1e-09 Identities = 31/84 (36%), Positives = 44/84 (52%) Frame = +1 Query: 103 VKCSELRTKDXXXXXXXXXXXXXXXTNLRVAKVTGGVASKLSKIRVVRKAIARVYIVYHQ 282 +K ELR + +LRV K+ GG SKLSKI+ RK IAR+ V ++ Sbjct: 3 LKTFELRKQSQENLAEQLQELRQELASLRVQKIAGGSGSKLSKIKTTRKDIARILTVINE 62 Query: 283 KMKVNLRNHYKNKKYKPLXFKSQE 354 ++ R YKNKKY PL + ++ Sbjct: 63 SNRLAAREAYKNKKYIPLDLRQKK 86 Score = 48.4 bits (110), Expect = 1e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +2 Query: 344 RAKKTRAMRKALTKHEAKIKTRKEIRKKSLFPPRVYAVKA 463 R KKTRA+R+ALT +E KT K+I+K+ FP R YA+KA Sbjct: 83 RQKKTRAIRRALTPYEQSRKTLKQIKKERYFPLRKYALKA 122 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,301,395 Number of Sequences: 5004 Number of extensions: 31956 Number of successful extensions: 66 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 466510270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -