BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H09 (917 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0340 + 17946133-17946136,17946207-17946342,17946428-179465... 67 2e-11 06_03_1515 - 30707600-30707613,30708093-30708167,30708596-307086... 35 0.10 >02_03_0340 + 17946133-17946136,17946207-17946342,17946428-17946584, 17947330-17947458 Length = 141 Score = 66.9 bits (156), Expect = 2e-11 Identities = 37/87 (42%), Positives = 48/87 (55%) Frame = +1 Query: 94 MGKVKCSELRTKDXXXXXXXXXXXXXXXTNLRVAKVTGGVASKLSKIRVVRKAIARVYIV 273 M ++K ELR K+ + LRVAKVTGG +KLSKI+VVR +IARV V Sbjct: 1 MARIKVDELRGKNKAELQAQLKDLKAELSLLRVAKVTGGAPNKLSKIKVVRTSIARVLTV 60 Query: 274 YHQKMKVNLRNHYKNKKYKPLXFKSQE 354 QK + LR YK K PL + ++ Sbjct: 61 ISQKQRAALREAYKKKSLLPLDLRPKK 87 Score = 32.3 bits (70), Expect = 0.56 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 18/58 (31%) Frame = +2 Query: 344 RAKKTRAMRKALTKH------------------EAKIKTRKEIRKKSLFPPRVYAVKA 463 R KKTRA+R+ LTKH + +KT +E +++ FP R YA+KA Sbjct: 84 RPKKTRAIRRRLTKHQLCYTCIRLLTFSMVAISQLSLKTEREKKREKYFPMRKYAIKA 141 >06_03_1515 - 30707600-30707613,30708093-30708167,30708596-30708647, 30708751-30708831,30709145-30709219,30709870-30709977, 30710026-30710032,30710133-30710268,30710361-30710685 Length = 290 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/60 (35%), Positives = 30/60 (50%) Frame = +1 Query: 88 VKMGKVKCSELRTKDXXXXXXXXXXXXXXXTNLRVAKVTGGVASKLSKIRVVRKAIARVY 267 V M ++K LR ++ + LRVA+VTGG +KLS I+ VR A+ Y Sbjct: 106 VAMARIKVDVLRGRNKAELQAQLKDLKAELSVLRVARVTGGAPNKLSNIK-VRTALREAY 164 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,318,799 Number of Sequences: 37544 Number of extensions: 244841 Number of successful extensions: 453 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2612387020 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -