BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H08 (906 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1919.15 |brl1|SPCC790.01, rfp2|ubiquitin-protein ligase E3 B... 27 4.8 SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyc... 26 8.5 >SPCC1919.15 |brl1|SPCC790.01, rfp2|ubiquitin-protein ligase E3 Brl1|Schizosaccharomyces pombe|chr 3|||Manual Length = 692 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 764 LNAYYYYFHSHLPFWWNSGKYGAFK 838 LN Y YF +H P K+G+FK Sbjct: 119 LNKYASYFQAHEPTLQKLAKFGSFK 143 >SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 615 Score = 25.8 bits (54), Expect = 8.5 Identities = 15/58 (25%), Positives = 32/58 (55%) Frame = -1 Query: 483 EHSLVHVDSGVACCFVETFKIFGIIEQLEQRDGFFPHFFVKDREFQILGKESDLVXHH 310 ++ +++VD +A CFV+ + G LE+ + + + + + F +LG+ L+ HH Sbjct: 539 DNLILNVDGCIAVCFVDLLRNCGAF-TLEEANEYI-NLGILNGMF-VLGRSIGLIGHH 593 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,231,837 Number of Sequences: 5004 Number of extensions: 61377 Number of successful extensions: 177 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 177 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 458501510 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -