BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H06 (879 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15782| Best HMM Match : DUF845 (HMM E-Value=5.8) 29 3.7 SB_2235| Best HMM Match : Arf (HMM E-Value=3.1e-13) 29 5.0 SB_34234| Best HMM Match : Galactosyl_T (HMM E-Value=0.0098) 29 6.6 SB_9094| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 >SB_15782| Best HMM Match : DUF845 (HMM E-Value=5.8) Length = 283 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 183 GFEENLMRNWVCLVEHESSRDTSKTN 260 GFEE + R W+ + E S D +KTN Sbjct: 33 GFEEEVKRQWIGCDKLEGSNDITKTN 58 >SB_2235| Best HMM Match : Arf (HMM E-Value=3.1e-13) Length = 334 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 176 ETWLRRKSHEELGMSGRAREQP*HVQDEHEP 268 E WL RK H E +S RE+ V+++H+P Sbjct: 223 EAWLERKEHREDSLSEHEREE---VKNKHKP 250 >SB_34234| Best HMM Match : Galactosyl_T (HMM E-Value=0.0098) Length = 1028 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -3 Query: 178 FLSSCTRPHLVNVLASRTNAEDNQSEN-N*LLHFXRXFRVTV 56 +L P L NVL++RTN + ++EN N F + +VTV Sbjct: 31 WLRDIPSPGLTNVLSNRTNHKGERAENSNSSADFIKKIKVTV 72 >SB_9094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 510 Score = 28.7 bits (61), Expect = 6.6 Identities = 22/78 (28%), Positives = 35/78 (44%) Frame = +3 Query: 180 HGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYWCSKGASPGKDCNVK 359 H + +++W+ + E RDT+ N + ++N+ W K K +VK Sbjct: 53 HEADPVAVKSWLKKLSEEQFRDTADKYLRPNNCSHVVVPKVNEEIW-GKLTRQVKTKDVK 111 Query: 360 CSDLLTDDITKAAKCAKK 413 S L T +ITKA A K Sbjct: 112 FSRLQT-NITKAGHIAVK 128 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,051,623 Number of Sequences: 59808 Number of extensions: 332513 Number of successful extensions: 717 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2502612210 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -