BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H06 (879 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33985.1 68417.m04822 expressed protein 29 5.4 At4g19940.1 68417.m02921 F-box family protein contains Pfam PF00... 28 9.5 >At4g33985.1 68417.m04822 expressed protein Length = 154 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 146 HEMRSRA*AEETWLRRKSHEELGMSGRAR 232 H A EE WLR+K + LG GR++ Sbjct: 19 HSWSPDADREEAWLRKKGKQSLGRLGRSK 47 >At4g19940.1 68417.m02921 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640: F-box protein interaction domain;similar to F-box protein Fbx8 (GI:6164735) [Homo sapiens]|8737673|gb|AV566223.1|AV566223 Length = 411 Score = 27.9 bits (59), Expect = 9.5 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -3 Query: 271 LRFVFVLDVSRLLSCSTRHTQFLMRFSSKP---CFLSSCTRPHLVNVLASRTNAEDN 110 +RF V + L CS T L++ SS P LSS HL VL S ++ D+ Sbjct: 53 MRFKSVSKLWSSLICSRNFTNRLLKLSSPPRLFMCLSSSDNSHLKTVLLSLSSPPDS 109 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,773,132 Number of Sequences: 28952 Number of extensions: 221825 Number of successful extensions: 611 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2067932800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -