BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H05 (878 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0458 + 14280953-14281866,14281964-14282912 31 0.92 04_03_0380 - 15150814-15152304 29 3.7 04_03_0348 + 14735581-14737071 29 3.7 >05_03_0458 + 14280953-14281866,14281964-14282912 Length = 620 Score = 31.5 bits (68), Expect = 0.92 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 746 QAFPPXNPPXALSCS-HPAXXRIPXPXFSPS 835 Q PP PP LSCS HP P P SPS Sbjct: 72 QPTPPPLPPTTLSCSSHPTPPPPPSPTTSPS 102 >04_03_0380 - 15150814-15152304 Length = 496 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = -3 Query: 870 RGEVXEKXXXFPEGEKXGXGIRXXAGWEQXSAXGGFXGGXA 748 RGEV EGEK R AGW++ +A GG A Sbjct: 432 RGEVAALIREAMEGEKGAEMRRRAAGWKEAAARAARPGGPA 472 >04_03_0348 + 14735581-14737071 Length = 496 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = -3 Query: 870 RGEVXEKXXXFPEGEKXGXGIRXXAGWEQXSAXGGFXGGXA 748 RGEV EGEK R AGW++ +A GG A Sbjct: 432 RGEVAALIREAMEGEKGAEMRRRAAGWKEAAARAARPGGPA 472 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,924,123 Number of Sequences: 37544 Number of extensions: 164541 Number of successful extensions: 234 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 233 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2479731924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -