BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_H03 (910 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0825 - 27986393-27986767,27987541-27987625,27987936-279880... 28 8.9 01_05_0679 + 24230740-24230929,24231330-24231461,24231710-242319... 28 8.9 >03_05_0825 - 27986393-27986767,27987541-27987625,27987936-27988036, 27988144-27988227,27988868-27988939,27989203-27989319, 27989386-27989526,27989951-27990122,27990324-27990372, 27990773-27990821,27991240-27991270,27991301-27991371 Length = 448 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 174 PKEDNSLNTLAESAKKTIEELREKVE 251 PKE ++ T+A + +KT EE+R +++ Sbjct: 91 PKESSTATTMAAATEKTAEEIRRELQ 116 >01_05_0679 + 24230740-24230929,24231330-24231461,24231710-24231977, 24232170-24232388,24233538-24233673,24233899-24234147, 24234783-24235100 Length = 503 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = +3 Query: 207 ESAKKTIEELR--EKVESALAPETVKKNFGTMVDSFNEFYKNLKPAE 341 E A+K E L+ +K +L PE +K+ F +++ +F +F L+P E Sbjct: 259 EEARKFNEALQRWDKNAVSLVPEGLKRFFLSIMSNFRDFEDELEPHE 305 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,045,015 Number of Sequences: 37544 Number of extensions: 219801 Number of successful extensions: 469 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 469 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2577242800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -