BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G23 (928 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 45 0.002 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 45 0.002 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 44 0.006 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 43 0.010 UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear... 43 0.013 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 42 0.017 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 42 0.017 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 42 0.017 UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC073... 42 0.017 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 42 0.017 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 42 0.017 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 42 0.017 UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnolioph... 42 0.017 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 42 0.017 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 42 0.017 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 42 0.017 UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 42 0.017 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 42 0.017 UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 42 0.017 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 42 0.017 UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, wh... 42 0.017 UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 42 0.017 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 42 0.017 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 42 0.017 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 42 0.017 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 42 0.017 UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein;... 42 0.022 UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lu... 42 0.022 UniRef50_A4S1A8 Cluster: Predicted protein; n=1; Ostreococcus lu... 41 0.039 UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=... 41 0.052 UniRef50_Q06KR7 Cluster: Viral capsid associated protein; n=3; N... 41 0.052 UniRef50_Q013M1 Cluster: Chromosome 08 contig 1, DNA sequence; n... 41 0.052 UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=... 41 0.052 UniRef50_Q00TR5 Cluster: Homology to unknown gene; n=3; Ostreoco... 40 0.068 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 40 0.068 UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|R... 40 0.090 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 40 0.090 UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysi... 40 0.090 UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thal... 40 0.090 UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. na... 40 0.090 UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-depe... 40 0.090 UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lu... 40 0.090 UniRef50_Q752A6 Cluster: AFR669Wp; n=1; Eremothecium gossypii|Re... 30 0.12 UniRef50_UPI00015BDD6A Cluster: UPI00015BDD6A related cluster; n... 40 0.12 UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucle... 40 0.12 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 40 0.12 UniRef50_Q2RTE8 Cluster: Putative uncharacterized protein; n=1; ... 40 0.12 UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Ricke... 40 0.12 UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole gen... 40 0.12 UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ... 40 0.12 UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas ... 40 0.12 UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, wh... 40 0.12 UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, wh... 40 0.12 UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1;... 40 0.12 UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA... 39 0.16 UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s... 39 0.16 UniRef50_Q9Q5L3 Cluster: EBNA-2; n=2; Cercopithecine herpesvirus... 39 0.16 UniRef50_Q4KT78 Cluster: ORF1629; n=2; Nucleopolyhedrovirus|Rep:... 39 0.16 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 39 0.16 UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 39 0.16 UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emilian... 39 0.16 UniRef50_Q0SAM5 Cluster: Putative uncharacterized protein; n=1; ... 39 0.16 UniRef50_Q0C0P5 Cluster: OmpA family protein; n=1; Hyphomonas ne... 39 0.16 UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like prote... 39 0.16 UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; ... 39 0.16 UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza... 39 0.16 UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; ... 39 0.16 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 39 0.16 UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg pr... 39 0.16 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 39 0.16 UniRef50_A3BQ84 Cluster: Putative uncharacterized protein; n=1; ... 39 0.16 UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, wh... 39 0.16 UniRef50_Q7SC01 Cluster: Predicted protein; n=1; Neurospora cras... 39 0.16 UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein... 39 0.16 UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Re... 39 0.21 UniRef50_Q84647 Cluster: A333L protein; n=1; Paramecium bursaria... 39 0.21 UniRef50_A5FXR4 Cluster: TonB family protein; n=1; Acidiphilium ... 39 0.21 UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sa... 39 0.21 UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vu... 39 0.21 UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n... 39 0.21 UniRef50_Q9VC76 Cluster: CG13615-PA; n=2; Sophophora|Rep: CG1361... 39 0.21 UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella ve... 39 0.21 UniRef50_A1CD74 Cluster: DUF1720 domain protein; n=17; Pezizomyc... 39 0.21 UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=... 39 0.21 UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain... 38 0.28 UniRef50_UPI0000F30E84 Cluster: UPI0000F30E84 related cluster; n... 38 0.28 UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa... 38 0.28 UniRef50_Q6YYS1 Cluster: Putative uncharacterized protein B1047A... 38 0.28 UniRef50_Q9FPQ6 Cluster: Vegetative cell wall protein gp1 precur... 38 0.28 UniRef50_UPI0000DA3E0C Cluster: PREDICTED: similar to tumor endo... 38 0.36 UniRef50_UPI0000DC00CB Cluster: SH3 domain binding protein CR16;... 38 0.36 UniRef50_UPI0000F30DFE Cluster: UPI0000F30DFE related cluster; n... 38 0.36 UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh... 38 0.36 UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2... 38 0.36 UniRef50_Q01B16 Cluster: Chromosome 04 contig 1, DNA sequence; n... 38 0.36 UniRef50_Q00S27 Cluster: Chromosome 19 contig 1, DNA sequence; n... 38 0.36 UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamy... 38 0.36 UniRef50_Q5CS67 Cluster: Signal peptide containing large protein... 38 0.36 UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyosteli... 38 0.36 UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyo... 38 0.36 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 38 0.36 UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella ve... 38 0.36 UniRef50_A2DXB4 Cluster: Formin Homology 2 Domain containing pro... 38 0.36 UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 38 0.36 UniRef50_Q9Y6V0 Cluster: Protein piccolo; n=17; Amniota|Rep: Pro... 38 0.36 UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|... 38 0.36 UniRef50_P13983 Cluster: Extensin precursor; n=1; Nicotiana taba... 38 0.36 UniRef50_Q4P6X2 Cluster: Putative uncharacterized protein; n=1; ... 30 0.44 UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome sh... 38 0.48 UniRef50_Q5CHL3 Cluster: Hydroxyproline-rich glycoprotein dz-hrg... 38 0.48 UniRef50_Q54U84 Cluster: Putative uncharacterized protein; n=1; ... 38 0.48 UniRef50_Q504V9 Cluster: ZNF341 protein; n=10; Euteleostomi|Rep:... 38 0.48 UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014... 38 0.48 UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; ... 38 0.48 UniRef50_Q9BYN7 Cluster: Zinc finger protein 341; n=86; Eumetazo... 38 0.48 UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - ... 38 0.48 UniRef50_Q9UPT8 Cluster: Zinc finger CCCH domain-containing prot... 38 0.48 UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein;... 37 0.64 UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n... 37 0.64 UniRef50_Q4SVG8 Cluster: Chromosome undetermined SCAF13758, whol... 37 0.64 UniRef50_A5IZX7 Cluster: Odv-e66; n=1; Spodoptera litura granulo... 37 0.64 UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: En... 37 0.64 UniRef50_Q0JD12 Cluster: Os04g0438100 protein; n=2; Oryza sativa... 37 0.64 UniRef50_Q013S1 Cluster: Chromosome 08 contig 1, DNA sequence; n... 37 0.64 UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; ... 37 0.64 UniRef50_Q86BM9 Cluster: CG33003-PA; n=1; Drosophila melanogaste... 37 0.64 UniRef50_Q581C6 Cluster: Flagellum-adhesion glycoprotein, putati... 37 0.64 UniRef50_Q20327 Cluster: Ground-like (Grd related) protein 4; n=... 37 0.64 UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; ... 37 0.64 UniRef50_Q9UMN6 Cluster: WW domain-binding protein 7; n=16; Euka... 37 0.64 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 37 0.64 UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleos... 37 0.64 UniRef50_A7P6N9 Cluster: Chromosome chr9 scaffold_7, whole genom... 30 0.79 UniRef50_UPI0000DD7BE7 Cluster: PREDICTED: hypothetical protein;... 37 0.84 UniRef50_UPI000069DF41 Cluster: UPI000069DF41 related cluster; n... 37 0.84 UniRef50_Q4TB69 Cluster: Chromosome 11 SCAF7190, whole genome sh... 37 0.84 UniRef50_Q6QXJ8 Cluster: ORF55; n=1; Agrotis segetum granuloviru... 37 0.84 UniRef50_Q2W2A9 Cluster: Periplasmic protein TonB, links inner a... 37 0.84 UniRef50_Q0M4S1 Cluster: TonB-like; n=1; Caulobacter sp. K31|Rep... 37 0.84 UniRef50_Q0LTW4 Cluster: Peptidase M56, BlaR1 precursor; n=1; Ca... 37 0.84 UniRef50_A5NQH0 Cluster: Putative uncharacterized protein precur... 37 0.84 UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; ... 37 0.84 UniRef50_A3Q1Z8 Cluster: Molecular chaperone-like; n=4; Mycobact... 37 0.84 UniRef50_A1UKQ7 Cluster: Putative uncharacterized protein; n=3; ... 37 0.84 UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian... 37 0.84 UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Exte... 37 0.84 UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassif... 37 0.84 UniRef50_O23374 Cluster: P140mDia like protein; n=2; Arabidopsis... 37 0.84 UniRef50_O23370 Cluster: Cell wall protein like; n=15; Magnoliop... 37 0.84 UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole gen... 37 0.84 UniRef50_A5BD28 Cluster: Putative uncharacterized protein; n=1; ... 37 0.84 UniRef50_Q55FU3 Cluster: Putative uncharacterized protein; n=1; ... 37 0.84 UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro... 37 0.84 UniRef50_A2F4E1 Cluster: Putative uncharacterized protein; n=1; ... 37 0.84 UniRef50_A2DI20 Cluster: Putative uncharacterized protein; n=1; ... 37 0.84 UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, w... 37 0.84 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 37 0.84 UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium glob... 37 0.84 UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; ... 37 0.84 UniRef50_Q03209 Cluster: 61 kDa protein; n=6; Nucleopolyhedrovir... 37 0.84 UniRef50_Q9QYX7 Cluster: Protein piccolo; n=22; cellular organis... 37 0.84 UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|R... 37 0.84 UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenas... 37 0.84 UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2... 36 1.1 UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein;... 36 1.1 UniRef50_UPI00015056F9 Cluster: DNA binding / ligand-dependent n... 36 1.1 UniRef50_UPI0000F2B900 Cluster: PREDICTED: hypothetical protein;... 36 1.1 UniRef50_UPI0000E21CCC Cluster: PREDICTED: similar to BAI 1, par... 36 1.1 UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein;... 36 1.1 UniRef50_UPI00015A5F90 Cluster: WAS protein homology region 2 do... 36 1.1 UniRef50_Q4THH6 Cluster: Chromosome undetermined SCAF2934, whole... 36 1.1 UniRef50_Q4SHS7 Cluster: Chromosome 5 SCAF14581, whole genome sh... 36 1.1 UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome s... 36 1.1 UniRef50_Q8UZB6 Cluster: Replicase; n=5; Grapevine fleck virus|R... 36 1.1 UniRef50_Q197B3 Cluster: Putative uncharacterized protein; n=1; ... 36 1.1 UniRef50_Q6PB68 Cluster: Bai1 protein; n=8; Euteleostomi|Rep: Ba... 36 1.1 UniRef50_Q3M5H7 Cluster: VCBS; n=2; Bacteria|Rep: VCBS - Anabaen... 36 1.1 UniRef50_A6G1X8 Cluster: Single-stranded DNA-binding protein; n=... 36 1.1 UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: ... 36 1.1 UniRef50_Q69XV3 Cluster: Putative glycine-rich cell wall structu... 36 1.1 UniRef50_Q0J2H9 Cluster: Os09g0341100 protein; n=8; Oryza sativa... 36 1.1 UniRef50_Q0DME4 Cluster: Os03g0813200 protein; n=4; Oryza sativa... 36 1.1 UniRef50_Q08194 Cluster: Cysteine-rich extensin-like protein-1; ... 36 1.1 UniRef50_A2XZD2 Cluster: Putative uncharacterized protein; n=2; ... 36 1.1 UniRef50_Q57WJ7 Cluster: Calpain, putative; n=3; Trypanosoma bru... 36 1.1 UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: F... 36 1.1 UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve... 36 1.1 UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella ve... 36 1.1 UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella ve... 36 1.1 UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; ... 36 1.1 UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing pro... 36 1.1 UniRef50_Q2HEQ9 Cluster: Predicted protein; n=1; Chaetomium glob... 36 1.1 UniRef50_P50552 Cluster: Vasodilator-stimulated phosphoprotein; ... 36 1.1 UniRef50_P48023 Cluster: Tumor necrosis factor ligand superfamil... 36 1.1 UniRef50_Q70E73 Cluster: Ras-associated and pleckstrin homology ... 36 1.1 UniRef50_Q96S59 Cluster: Ran-binding protein 9; n=51; Euteleosto... 36 1.1 UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda... 36 1.1 UniRef50_O14514 Cluster: Brain-specific angiogenesis inhibitor 1... 36 1.1 UniRef50_Q7Z5R6 Cluster: Amyloid beta A4 precursor protein-bindi... 36 1.1 UniRef50_A7QQ26 Cluster: Chromosome chr2 scaffold_140, whole gen... 34 1.3 UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 ... 36 1.5 UniRef50_UPI0000F1E76D Cluster: PREDICTED: hypothetical protein;... 36 1.5 UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein;... 36 1.5 UniRef50_Q8BEN8 Cluster: ORF58; n=1; Callitrichine herpesvirus 3... 36 1.5 UniRef50_Q3UHZ5 Cluster: 17 days embryo heart cDNA, RIKEN full-l... 36 1.5 UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2... 36 1.5 UniRef50_A5G2K8 Cluster: Putative uncharacterized protein; n=1; ... 36 1.5 UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. na... 36 1.5 UniRef50_Q7XAL2 Cluster: Extensin-like protein; n=1; Oryza sativ... 36 1.5 UniRef50_Q41192 Cluster: NaPRP3; n=1; Nicotiana alata|Rep: NaPRP... 36 1.5 UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=... 36 1.5 UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n... 36 1.5 UniRef50_O48809 Cluster: T3P18.1; n=9; Eukaryota|Rep: T3P18.1 - ... 36 1.5 UniRef50_A7QHZ4 Cluster: Chromosome chr17 scaffold_101, whole ge... 36 1.5 UniRef50_A4SBI2 Cluster: Predicted protein; n=1; Ostreococcus lu... 36 1.5 UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyosteli... 36 1.5 UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, wh... 36 1.5 UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, wh... 36 1.5 UniRef50_Q9C0F0 Cluster: Protein KIAA1713; n=33; Deuterostomia|R... 36 1.5 UniRef50_Q86UP3 Cluster: Zinc finger homeobox protein 4; n=18; E... 36 1.5 UniRef50_UPI00015B56FF Cluster: PREDICTED: similar to splicing f... 36 1.9 UniRef50_UPI0000F2E6AE Cluster: PREDICTED: hypothetical protein;... 36 1.9 UniRef50_UPI0000F2E662 Cluster: PREDICTED: similar to CBLL1 prot... 36 1.9 UniRef50_UPI0000F2CE07 Cluster: PREDICTED: hypothetical protein;... 36 1.9 UniRef50_UPI0000F2CB43 Cluster: PREDICTED: hypothetical protein;... 36 1.9 UniRef50_UPI0000F2C731 Cluster: PREDICTED: hypothetical protein;... 36 1.9 UniRef50_UPI0000F2C6D3 Cluster: PREDICTED: hypothetical protein;... 36 1.9 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 36 1.9 UniRef50_UPI0000F1F796 Cluster: PREDICTED: hypothetical protein;... 36 1.9 UniRef50_UPI0000E7FB87 Cluster: PREDICTED: similar to class IV P... 36 1.9 UniRef50_UPI0000E48B55 Cluster: PREDICTED: hypothetical protein;... 36 1.9 UniRef50_UPI0000DB75B1 Cluster: PREDICTED: similar to One cut do... 36 1.9 UniRef50_UPI0000DB6FB3 Cluster: PREDICTED: similar to plexus CG4... 36 1.9 UniRef50_UPI0000DB6D2F Cluster: PREDICTED: hypothetical protein;... 36 1.9 UniRef50_UPI0000DA32FB Cluster: PREDICTED: hypothetical protein;... 36 1.9 UniRef50_UPI0000DA1F29 Cluster: PREDICTED: hypothetical protein;... 36 1.9 UniRef50_UPI0000DA1EB9 Cluster: PREDICTED: hypothetical protein;... 36 1.9 UniRef50_UPI0000D561BD Cluster: PREDICTED: hypothetical protein;... 36 1.9 UniRef50_UPI0000DC1DE1 Cluster: Exocyst complex component 3 (Exo... 36 1.9 UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome s... 36 1.9 UniRef50_Q4RQW5 Cluster: Chromosome 14 SCAF15003, whole genome s... 36 1.9 UniRef50_Q91TR1 Cluster: T32; n=1; Tupaiid herpesvirus 1|Rep: T3... 36 1.9 UniRef50_Q8VAY0 Cluster: Wsv239; n=1; Shrimp white spot syndrome... 36 1.9 UniRef50_Q8QKX8 Cluster: EsV-1-144; n=1; Ectocarpus siliculosus ... 36 1.9 UniRef50_Q4A2U2 Cluster: Putative membrane protein precursor; n=... 36 1.9 UniRef50_Q92NU7 Cluster: PUTATIVE GLYCINE-RICH PROTEIN; n=4; Sin... 36 1.9 UniRef50_Q127H7 Cluster: Putative uncharacterized protein precur... 36 1.9 UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subuni... 36 1.9 UniRef50_A1TJK5 Cluster: Putative uncharacterized protein; n=4; ... 36 1.9 UniRef50_A0YZF2 Cluster: Putative uncharacterized protein; n=2; ... 36 1.9 UniRef50_A0LQ52 Cluster: Putative uncharacterized protein; n=1; ... 36 1.9 UniRef50_A0ADW6 Cluster: Putative secreted proline-rich protein;... 36 1.9 UniRef50_Q9SRL3 Cluster: F9F8.15 protein; n=13; Magnoliophyta|Re... 36 1.9 UniRef50_Q9LU79 Cluster: Gb|AAF21150.1; n=2; Arabidopsis thalian... 36 1.9 UniRef50_Q9LJ64 Cluster: Extensin protein-like; n=8; Eukaryota|R... 36 1.9 UniRef50_Q8RUS0 Cluster: Putative uncharacterized protein At2g18... 36 1.9 UniRef50_Q75QN8 Cluster: Cold shock domain protein 3; n=2; Triti... 36 1.9 UniRef50_Q6ZLD1 Cluster: Putative RRM RNA binding protein NSAP1;... 36 1.9 UniRef50_Q651Z0 Cluster: RNA-binding protein-like; n=4; Oryza sa... 36 1.9 UniRef50_Q43522 Cluster: Tfm5 protein; n=9; Magnoliophyta|Rep: T... 36 1.9 UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=... 36 1.9 UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa... 36 1.9 UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Re... 36 1.9 UniRef50_Q01LP7 Cluster: OSIGBa0150M16.1 protein; n=10; Oryza sa... 36 1.9 UniRef50_O49946 Cluster: Extensin-like protein; n=5; Solanaceae|... 36 1.9 UniRef50_A4S5W2 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 36 1.9 UniRef50_A2X6K1 Cluster: Putative uncharacterized protein; n=3; ... 36 1.9 UniRef50_A2WLE1 Cluster: Putative uncharacterized protein; n=2; ... 36 1.9 UniRef50_Q9VEP4 Cluster: CG5225-PA; n=2; Drosophila melanogaster... 36 1.9 UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23... 36 1.9 UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila m... 36 1.9 UniRef50_Q7PNI8 Cluster: ENSANGP00000013088; n=1; Anopheles gamb... 36 1.9 UniRef50_Q61QV1 Cluster: Putative uncharacterized protein CBG068... 36 1.9 UniRef50_Q5CN76 Cluster: Putative uncharacterized protein; n=2; ... 36 1.9 UniRef50_Q18880 Cluster: Putative uncharacterized protein grl-17... 36 1.9 UniRef50_A7RF28 Cluster: Predicted protein; n=1; Nematostella ve... 36 1.9 UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: ... 36 1.9 UniRef50_Q96JH1 Cluster: KIAA1856 protein; n=21; Eutheria|Rep: K... 36 1.9 UniRef50_Q560V3 Cluster: Putative uncharacterized protein; n=2; ... 36 1.9 UniRef50_Q0CUB4 Cluster: Predicted protein; n=1; Aspergillus ter... 36 1.9 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 36 1.9 UniRef50_A3LVW7 Cluster: Predicted protein; n=1; Pichia stipitis... 36 1.9 UniRef50_Q9Y6X0 Cluster: SET-binding protein; n=26; Tetrapoda|Re... 36 1.9 UniRef50_Q9ULL5 Cluster: Proline-rich protein 12; n=19; Eutheria... 36 1.9 UniRef50_P10323 Cluster: Acrosin precursor (EC 3.4.21.10) [Conta... 36 1.9 UniRef50_UPI0001554687 Cluster: PREDICTED: similar to breast can... 29 2.2 UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe... 35 2.6 UniRef50_UPI0000DC03C7 Cluster: formin-like 2; n=1; Rattus norve... 35 2.6 UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; ... 35 2.6 UniRef50_Q65553 Cluster: UL36; n=5; Varicellovirus|Rep: UL36 - B... 35 2.6 UniRef50_Q4A371 Cluster: Putative membrane protein precursor; n=... 35 2.6 UniRef50_Q287S0 Cluster: ORF1629; n=1; Agrotis segetum nucleopol... 35 2.6 UniRef50_Q3UQ97 Cluster: 10 days lactation, adult female mammary... 35 2.6 UniRef50_Q8FY77 Cluster: Intimin/invasin family protein; n=4; Br... 35 2.6 UniRef50_A6FX13 Cluster: Nitrilase/cyanide hydratase and apolipo... 35 2.6 UniRef50_A1W9I9 Cluster: TonB family protein; n=3; Comamonadacea... 35 2.6 UniRef50_A1TPB5 Cluster: TonB family protein; n=1; Acidovorax av... 35 2.6 UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thali... 35 2.6 UniRef50_Q75GQ8 Cluster: Expressed protein; n=2; Oryza sativa|Re... 35 2.6 UniRef50_Q6K8Z4 Cluster: Diaphanous homologue-like; n=6; Oryza s... 35 2.6 UniRef50_Q09085 Cluster: Hydroxyproline-rich glycoprotein; n=2; ... 35 2.6 UniRef50_Q019U6 Cluster: Leucine permease transcriptional regula... 35 2.6 UniRef50_A5HIJ5 Cluster: Cysteine protease Cp5; n=6; Magnoliophy... 35 2.6 UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; ... 35 2.6 UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba hist... 35 2.6 UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos... 35 2.6 UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Pro... 35 2.6 UniRef50_Q4XND7 Cluster: Putative uncharacterized protein; n=1; ... 35 2.6 UniRef50_A2FMX2 Cluster: DnaK protein; n=2; Trichomonas vaginali... 35 2.6 UniRef50_A2DM31 Cluster: Putative uncharacterized protein; n=1; ... 35 2.6 UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w... 35 2.6 UniRef50_Q5T8W7 Cluster: Espin; n=51; Euteleostomi|Rep: Espin - ... 35 2.6 UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; ... 35 2.6 UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; ... 35 2.6 UniRef50_A3LN86 Cluster: Protein involved in actin organization ... 35 2.6 UniRef50_Q6P0D5 Cluster: WW domain-binding protein 11; n=7; Eute... 35 2.6 UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein... 35 2.6 UniRef50_Q61900 Cluster: Submaxillary gland androgen-regulated p... 35 2.6 UniRef50_A0DMD8 Cluster: Chromosome undetermined scaffold_56, wh... 30 2.7 UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; ... 34 3.0 UniRef50_Q0JLP7 Cluster: Os01g0584100 protein; n=5; Oryza sativa... 27 3.1 UniRef50_UPI000155D461 Cluster: PREDICTED: similar to Mitogen-ac... 35 3.4 UniRef50_UPI0000F2117C Cluster: PREDICTED: hypothetical protein;... 35 3.4 UniRef50_UPI0000E492FA Cluster: PREDICTED: similar to L-delphili... 35 3.4 UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelle... 35 3.4 UniRef50_Q4T6G3 Cluster: Chromosome undetermined SCAF8768, whole... 35 3.4 UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh... 35 3.4 UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|R... 35 3.4 UniRef50_A7BM53 Cluster: Putative uncharacterized protein; n=1; ... 35 3.4 UniRef50_Q9XIB6 Cluster: F13F21.7 protein; n=5; core eudicotyled... 35 3.4 UniRef50_Q8LJ87 Cluster: Putative leucine-rich repeat/extensin 1... 35 3.4 UniRef50_Q39620 Cluster: VSP-3 protein precursor; n=2; Chlamydom... 35 3.4 UniRef50_O65530 Cluster: Putative uncharacterized protein F4D11.... 35 3.4 UniRef50_A4RS69 Cluster: Predicted protein; n=1; Ostreococcus lu... 35 3.4 UniRef50_A2WU17 Cluster: Putative uncharacterized protein; n=3; ... 35 3.4 UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b... 35 3.4 UniRef50_Q5CXX9 Cluster: Sgnal peptide, large secreted protein; ... 35 3.4 UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli... 35 3.4 UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|R... 35 3.4 UniRef50_O96853 Cluster: ORF 1; n=1; Schistosoma haematobium|Rep... 35 3.4 UniRef50_Q4PIM3 Cluster: Putative uncharacterized protein; n=1; ... 35 3.4 UniRef50_Q0UQG7 Cluster: Adenylyl cyclase-associated protein; n=... 35 3.4 UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2;... 35 3.4 UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [C... 35 3.4 UniRef50_Q6BSP4 Cluster: Branchpoint-bridging protein; n=2; Sacc... 35 3.4 UniRef50_P40602 Cluster: Anter-specific proline-rich protein APG... 35 3.4 UniRef50_UPI000069E970 Cluster: espin-like; n=2; Xenopus tropica... 31 3.8 UniRef50_A7S9G8 Cluster: Predicted protein; n=1; Nematostella ve... 27 4.0 UniRef50_UPI0000D55F3A Cluster: PREDICTED: similar to CG14622-PC... 34 4.5 UniRef50_Q5SFM8-3 Cluster: Isoform 3 of Q5SFM8 ; n=8; Tetrapoda|... 34 4.5 UniRef50_Q7SZN7 Cluster: Enah/Vasp-like a; n=3; Danio rerio|Rep:... 34 4.5 UniRef50_Q4SZ13 Cluster: Chromosome 2 SCAF11863, whole genome sh... 34 4.5 UniRef50_Q9QAT4 Cluster: T-lymphocyte surface antigen CD2 homolo... 34 4.5 UniRef50_Q7WFN5 Cluster: Proline-rich inner membrane protein; n=... 34 4.5 UniRef50_Q4UR32 Cluster: Glycine rich protein; n=10; Proteobacte... 34 4.5 UniRef50_Q3W130 Cluster: Similar to ATPases involved in chromoso... 34 4.5 UniRef50_Q1GYT0 Cluster: Putative uncharacterized protein; n=1; ... 34 4.5 UniRef50_Q0RSN4 Cluster: Putative uncharacterized protein; n=1; ... 34 4.5 UniRef50_A3TG79 Cluster: Putative uncharacterized protein; n=1; ... 34 4.5 UniRef50_A2SM82 Cluster: Periplasmic protein/ biopolymer transpo... 34 4.5 UniRef50_A1W8T6 Cluster: Nuclease; n=1; Acidovorax sp. JS42|Rep:... 34 4.5 UniRef50_A1T6E3 Cluster: Putative uncharacterized protein; n=3; ... 34 4.5 UniRef50_A1G4V0 Cluster: Putative uncharacterized protein; n=2; ... 34 4.5 UniRef50_Q8S9B6 Cluster: PR-1 like protein; n=1; Volvox carteri ... 34 4.5 UniRef50_Q7G491 Cluster: Transposon protein, putative, CACTA, En... 34 4.5 UniRef50_Q6Z495 Cluster: Putative glycine-rich cell wall structu... 34 4.5 UniRef50_Q6YWA5 Cluster: Putative uncharacterized protein P0501E... 34 4.5 UniRef50_Q41848 Cluster: Prolin rich protein; n=6; Poaceae|Rep: ... 34 4.5 UniRef50_Q2R360 Cluster: C2 domain containing protein, expressed... 34 4.5 UniRef50_Q2QS51 Cluster: Transposon protein, putative, CACTA, En... 34 4.5 UniRef50_Q0JA38 Cluster: Os04g0617200 protein; n=2; Oryza sativa... 34 4.5 UniRef50_Q01942 Cluster: Extensin; n=22; root|Rep: Extensin - So... 34 4.5 UniRef50_Q015H7 Cluster: Chromosome 07 contig 1, DNA sequence; n... 34 4.5 UniRef50_O65514 Cluster: Putative glycine-rich cell wall protein... 34 4.5 UniRef50_A5BL77 Cluster: Putative uncharacterized protein; n=1; ... 34 4.5 UniRef50_A5BDJ3 Cluster: Putative uncharacterized protein; n=1; ... 34 4.5 UniRef50_A3BZ04 Cluster: Putative uncharacterized protein; n=2; ... 34 4.5 UniRef50_Q22CA6 Cluster: Annexin homolog protein; n=3; Tetrahyme... 34 4.5 UniRef50_Q00486 Cluster: Mini-collagen precursor; n=2; Hydra sp.... 34 4.5 UniRef50_A2ETA3 Cluster: WH2 motif family protein; n=1; Trichomo... 34 4.5 UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing pro... 34 4.5 UniRef50_A6NGB9 Cluster: Uncharacterized protein WIPF3; n=17; Th... 34 4.5 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 34 4.5 UniRef50_Q5KGJ5 Cluster: Putative uncharacterized protein; n=2; ... 34 4.5 UniRef50_Q4WG58 Cluster: Actin cortical patch assembly protein P... 34 4.5 UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; ... 34 4.5 UniRef50_Q0U760 Cluster: Putative uncharacterized protein; n=1; ... 34 4.5 UniRef50_Q0U2K7 Cluster: Putative uncharacterized protein; n=1; ... 34 4.5 UniRef50_A7ER22 Cluster: Predicted protein; n=1; Sclerotinia scl... 34 4.5 UniRef50_Q9P2N5 Cluster: RNA-binding protein 27; n=20; Euteleost... 34 4.5 UniRef50_A7RF99 Cluster: Predicted protein; n=1; Nematostella ve... 27 5.1 UniRef50_Q9M3G8 Cluster: Putative proline-rich protein; n=2; Ara... 29 5.4 UniRef50_UPI0000F2D0E5 Cluster: PREDICTED: similar to gametogene... 34 5.9 UniRef50_UPI0000F21440 Cluster: PREDICTED: hypothetical protein;... 34 5.9 UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein ca... 34 5.9 UniRef50_UPI0000DB6EF9 Cluster: PREDICTED: hypothetical protein;... 34 5.9 UniRef50_UPI00006A0729 Cluster: UPI00006A0729 related cluster; n... 34 5.9 UniRef50_UPI00004D5DA1 Cluster: YLP motif containing protein 1 (... 34 5.9 UniRef50_UPI000065D9FC Cluster: Ras-associated and pleckstrin ho... 34 5.9 UniRef50_UPI0000F31545 Cluster: UPI0000F31545 related cluster; n... 34 5.9 UniRef50_Q4KLX2 Cluster: MGC114656 protein; n=1; Xenopus laevis|... 34 5.9 UniRef50_A2RV11 Cluster: FNBP4 protein; n=7; Danio rerio|Rep: FN... 34 5.9 UniRef50_Q9YMX1 Cluster: Essential structural protein pp78-81; n... 34 5.9 UniRef50_Q91F15 Cluster: ORF38 similar to XcGV ORF33; n=1; Cydia... 34 5.9 UniRef50_Q4A2G4 Cluster: Putative membrane protein precursor; n=... 34 5.9 UniRef50_Q9A3H3 Cluster: Putative uncharacterized protein; n=2; ... 34 5.9 UniRef50_Q89X06 Cluster: Blr0521 protein; n=7; Bradyrhizobiaceae... 34 5.9 UniRef50_Q825Z2 Cluster: Putative proline-rich protein; n=2; Str... 34 5.9 UniRef50_Q39WE6 Cluster: Putative uncharacterized protein; n=2; ... 34 5.9 UniRef50_Q2IIP5 Cluster: Putative uncharacterized protein; n=1; ... 34 5.9 UniRef50_Q3VZ30 Cluster: Putative uncharacterized protein; n=1; ... 34 5.9 UniRef50_A5V8M1 Cluster: OmpA/MotB domain protein precursor; n=3... 34 5.9 UniRef50_A0G4N3 Cluster: Putative uncharacterized protein precur... 34 5.9 UniRef50_Q9XIP3 Cluster: Putative uncharacterized protein At2g27... 34 5.9 UniRef50_Q9FM99 Cluster: Similarity to carbonic anhydrase; n=1; ... 34 5.9 UniRef50_Q9ATK5 Cluster: PF6 protein; n=1; Chlamydomonas reinhar... 34 5.9 UniRef50_Q8L7S5 Cluster: AT4g18560/F28J12_220; n=2; Arabidopsis ... 34 5.9 UniRef50_Q10I10 Cluster: Transposon protein, putative, CACTA, En... 34 5.9 UniRef50_Q0JDV1 Cluster: Os04g0373000 protein; n=2; Magnoliophyt... 34 5.9 UniRef50_Q0J779 Cluster: Os08g0223700 protein; n=5; Eukaryota|Re... 34 5.9 UniRef50_Q01MF2 Cluster: OSIGBa0091B08.4 protein; n=1; Oryza sat... 34 5.9 UniRef50_Q01A68 Cluster: Chromosome 04 contig 1, DNA sequence; n... 34 5.9 UniRef50_A4RW22 Cluster: Predicted protein; n=1; Ostreococcus lu... 34 5.9 UniRef50_Q612S1 Cluster: Putative uncharacterized protein CBG166... 34 5.9 UniRef50_Q5CKJ5 Cluster: Putative uncharacterized protein; n=1; ... 34 5.9 UniRef50_Q54HS3 Cluster: SET domain-containing protein; n=1; Dic... 34 5.9 UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; ... 34 5.9 UniRef50_A7STU3 Cluster: Predicted protein; n=1; Nematostella ve... 34 5.9 UniRef50_A7SEJ5 Cluster: Predicted protein; n=2; Nematostella ve... 34 5.9 UniRef50_A7RV64 Cluster: Predicted protein; n=2; Nematostella ve... 34 5.9 UniRef50_A2FBC2 Cluster: Putative uncharacterized protein; n=1; ... 34 5.9 UniRef50_Q9C0D6 Cluster: KIAA1727 protein; n=13; Tetrapoda|Rep: ... 34 5.9 UniRef50_Q7RXV4 Cluster: Predicted protein; n=2; Neurospora cras... 34 5.9 UniRef50_Q6FX25 Cluster: Similarities with sp|P08640 Saccharomyc... 34 5.9 UniRef50_Q4PDN5 Cluster: Putative uncharacterized protein; n=1; ... 34 5.9 UniRef50_Q2H9M3 Cluster: Putative uncharacterized protein; n=1; ... 34 5.9 UniRef50_Q2GRP0 Cluster: Putative uncharacterized protein; n=1; ... 34 5.9 UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ... 34 5.9 UniRef50_Q0V288 Cluster: Predicted protein; n=1; Phaeosphaeria n... 34 5.9 UniRef50_Q0UXS5 Cluster: Putative uncharacterized protein; n=1; ... 34 5.9 UniRef50_A6S8L3 Cluster: Predicted protein; n=2; Botryotinia fuc... 34 5.9 UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe gri... 34 5.9 UniRef50_A4QSH6 Cluster: Predicted protein; n=1; Magnaporthe gri... 34 5.9 UniRef50_A3GHC4 Cluster: Predicted protein; n=1; Pichia stipitis... 34 5.9 UniRef50_O95409 Cluster: Zinc finger protein ZIC 2; n=126; Coelo... 34 5.9 UniRef50_O43516 Cluster: WAS/WASL-interacting protein family mem... 34 5.9 UniRef50_Q12929 Cluster: Epidermal growth factor receptor kinase... 34 5.9 UniRef50_P23093 Cluster: Circumsporozoite protein precursor; n=3... 34 5.9 UniRef50_Q27294 Cluster: RNA-binding protein cabeza; n=5; Endopt... 34 5.9 UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila mel... 34 5.9 UniRef50_Q6MWG9 Cluster: B1160F02.7 protein; n=3; Oryza sativa|R... 30 6.3 UniRef50_UPI00015B5315 Cluster: PREDICTED: similar to Heterogene... 33 7.8 UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein;... 33 7.8 UniRef50_UPI0000F1EEC4 Cluster: PREDICTED: hypothetical protein;... 33 7.8 UniRef50_UPI0000E7FD76 Cluster: PREDICTED: similar to SH3 domain... 33 7.8 UniRef50_UPI0000E4A721 Cluster: PREDICTED: similar to LOC397922 ... 33 7.8 UniRef50_UPI0000E4626F Cluster: PREDICTED: similar to heterogene... 33 7.8 UniRef50_UPI0000DB7618 Cluster: PREDICTED: hypothetical protein;... 33 7.8 UniRef50_UPI0000DA2269 Cluster: PREDICTED: similar to Formin-1 i... 33 7.8 UniRef50_UPI0000DA1F1A Cluster: PREDICTED: hypothetical protein;... 33 7.8 UniRef50_UPI000049858C Cluster: hypothetical protein 101.t00009;... 33 7.8 UniRef50_UPI00006A072A Cluster: UPI00006A072A related cluster; n... 33 7.8 UniRef50_UPI0000DC061A Cluster: UPI0000DC061A related cluster; n... 33 7.8 UniRef50_UPI0000DC0617 Cluster: UPI0000DC0617 related cluster; n... 33 7.8 UniRef50_UPI0000DC00C7 Cluster: UPI0000DC00C7 related cluster; n... 33 7.8 UniRef50_UPI000065EE09 Cluster: formin binding protein 4; n=1; T... 33 7.8 UniRef50_UPI0000ECCC14 Cluster: WAS/WASL interacting protein fam... 33 7.8 UniRef50_P42859-2 Cluster: Isoform Short of P42859 ; n=7; Deuter... 33 7.8 UniRef50_Q9DGN3 Cluster: Espin; n=4; Gallus gallus|Rep: Espin - ... 33 7.8 UniRef50_Q4REK0 Cluster: Chromosome 10 SCAF15123, whole genome s... 33 7.8 UniRef50_Q8UZ17 Cluster: E2 protein; n=1; Phocoena spinipinnis p... 33 7.8 UniRef50_Q8QNH5 Cluster: EsV-1-103; n=1; Ectocarpus siliculosus ... 33 7.8 UniRef50_Q7NUD4 Cluster: Probable transmembrane protein; n=1; Ch... 33 7.8 UniRef50_Q3KEU2 Cluster: Putative uncharacterized protein precur... 33 7.8 UniRef50_Q1H109 Cluster: TonB-like protein; n=1; Methylobacillus... 33 7.8 UniRef50_Q1GRM3 Cluster: OmpA/MotB precursor; n=7; Sphingomonada... 33 7.8 UniRef50_A5CN16 Cluster: Hypothetical secreted protein, putative... 33 7.8 UniRef50_A4X141 Cluster: Putative uncharacterized protein; n=1; ... 33 7.8 UniRef50_A3Q7Z4 Cluster: Putative uncharacterized protein; n=3; ... 33 7.8 UniRef50_A2SHS7 Cluster: Putative transmembrane protein; n=1; Me... 33 7.8 UniRef50_A0J0A0 Cluster: Putative lipoprotein precursor; n=2; Al... 33 7.8 UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis tha... 33 7.8 UniRef50_Q9SN04 Cluster: Putative uncharacterized protein F3A4.2... 33 7.8 UniRef50_Q6NMD9 Cluster: At1g02405; n=1; Arabidopsis thaliana|Re... 33 7.8 UniRef50_Q69T79 Cluster: Putative glycine-rich cell wall structu... 33 7.8 UniRef50_Q5JNC9 Cluster: Putative receptor protein kinase PERK1;... 33 7.8 UniRef50_Q2QVK5 Cluster: Transposon protein, putative, CACTA, En... 33 7.8 UniRef50_Q2QR52 Cluster: Transposon protein, putative, CACTA, En... 33 7.8 UniRef50_Q0JM52 Cluster: Os01g0536600 protein; n=3; Oryza sativa... 33 7.8 UniRef50_Q01LA2 Cluster: OSIGBa0113L04.6 protein; n=4; Oryza sat... 33 7.8 UniRef50_Q01L28 Cluster: OSIGBa0147J02.2 protein; n=7; Oryza sat... 33 7.8 UniRef50_A5BAX2 Cluster: Putative uncharacterized protein; n=1; ... 33 7.8 UniRef50_A4S3R1 Cluster: Predicted protein; n=2; Ostreococcus|Re... 33 7.8 UniRef50_A2XRQ0 Cluster: Putative uncharacterized protein; n=1; ... 33 7.8 UniRef50_Q9W4V1 Cluster: CG3588-PB, isoform B; n=20; melanogaste... 33 7.8 UniRef50_Q9VAT0 Cluster: CG1520-PA, isoform A; n=3; Sophophora|R... 33 7.8 UniRef50_Q8WT46 Cluster: Putative uncharacterized protein; n=3; ... 33 7.8 UniRef50_Q54LW3 Cluster: Putative uncharacterized protein; n=1; ... 33 7.8 UniRef50_Q54CK9 Cluster: Putative uncharacterized protein; n=1; ... 33 7.8 UniRef50_O01900 Cluster: Putative uncharacterized protein; n=2; ... 33 7.8 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P PSP P P PP P P P Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 468 Query: 922 P 924 P Sbjct: 469 P 469 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 268 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 300 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 276 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 308 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 325 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 357 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 333 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 365 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 369 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 401 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 377 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 409 Score = 42.3 bits (95), Expect = 0.017 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = +1 Query: 730 SXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXP 909 S PP PP P P PP P PSP P P PP P Sbjct: 389 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 448 Query: 910 XPXPP 924 P PP Sbjct: 449 PPSPP 453 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 423 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 455 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 431 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 463 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 439 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 471 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 447 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 479 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 483 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 515 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 491 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 523 Score = 41.9 bits (94), Expect = 0.022 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P PSP P P PP P P P Sbjct: 238 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 297 Query: 922 P 924 P Sbjct: 298 P 298 Score = 41.9 bits (94), Expect = 0.022 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P PSP P P PP P P P Sbjct: 339 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 398 Query: 922 P 924 P Sbjct: 399 P 399 Score = 41.9 bits (94), Expect = 0.022 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P PSP P P PP P P P Sbjct: 453 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 512 Query: 922 P 924 P Sbjct: 513 P 513 Score = 41.1 bits (92), Expect = 0.039 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P PSP P P PP P P P Sbjct: 298 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSP---PPPPPPSPPPPPPPSPPPPPPPSP 354 Query: 922 P 924 P Sbjct: 355 P 355 Score = 41.1 bits (92), Expect = 0.039 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P PSP P P PP P P P Sbjct: 404 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP---PPPPPPSPPPPPPPSPPPPPPPSP 460 Query: 922 P 924 P Sbjct: 461 P 461 Score = 41.1 bits (92), Expect = 0.039 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PP P PP P PP Sbjct: 430 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 462 Score = 41.1 bits (92), Expect = 0.039 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PP P PP P PP Sbjct: 438 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 470 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 210 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 242 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 215 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 247 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 224 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 256 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 232 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 264 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 237 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 269 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 281 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 313 Score = 39.1 bits (87), Expect = 0.16 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 283 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPP 317 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 289 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 321 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 294 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 326 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 338 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 370 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 382 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 414 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 452 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 484 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 496 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 528 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 510 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 542 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 515 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 547 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 524 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 556 Score = 37.9 bits (84), Expect = 0.36 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PPP PPP P PP P PP Sbjct: 227 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 260 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PP P P P PP Sbjct: 384 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 416 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PP P P P PP Sbjct: 498 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 530 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PP P PP P PP Sbjct: 506 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 538 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 190 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 222 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 195 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 227 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 200 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 232 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 205 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 237 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP PP P PP Sbjct: 214 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 246 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP PP P PP Sbjct: 219 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 251 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 220 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 252 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 225 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 257 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PP P PP P PP Sbjct: 229 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 261 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP PP P PP Sbjct: 271 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 303 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 290 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 322 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 295 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 327 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP PP P PP Sbjct: 328 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 360 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP PP P PP Sbjct: 372 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 404 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P P P PP Sbjct: 383 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 415 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP PP P PP Sbjct: 442 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 474 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP PP P PP Sbjct: 486 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 518 Score = 35.9 bits (79), Expect = 1.5 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPX--PXPSPXXXPXPXPPXXPXP 915 PP P PP P P PP P PSP P P PP P P Sbjct: 492 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP-PPSP 550 Query: 916 XPP 924 PP Sbjct: 551 PPP 553 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P P P PP Sbjct: 497 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 529 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 505 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 537 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP PP P PP Sbjct: 514 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 546 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP PP P PP Sbjct: 519 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 551 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 520 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 552 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 525 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 557 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 193 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 223 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 198 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 228 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 203 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 233 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 208 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 238 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 243 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 218 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 513 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 543 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 518 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 548 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PPP P P P PP Sbjct: 528 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 34.7 bits (76), Expect = 3.4 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P P P PSP P P PP P P P Sbjct: 194 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP-PPSPPP 252 Query: 922 P 924 P Sbjct: 253 P 253 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXPP 925 P PP P P P PPP P PP P PP Sbjct: 279 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 312 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP--XPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 297 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 331 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P PSP P P PP P P P Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Query: 922 P 924 P Sbjct: 294 P 294 Score = 44.4 bits (100), Expect = 0.004 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 232 PSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPP 264 Score = 44.4 bits (100), Expect = 0.004 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 236 PSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPP 268 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 251 PSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 41.1 bits (92), Expect = 0.039 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PP PPP P PP P PP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPP 258 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 227 PPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPP 259 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P P PP P P PP Sbjct: 230 PPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPP 262 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PP P PPP P PP P PP Sbjct: 215 PNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPP 247 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PP PPP P P P PP Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPP 260 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 37.1 bits (82), Expect = 0.64 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P P PP P PP Sbjct: 219 PSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPP 251 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PPPP PPP P PP P P Sbjct: 274 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PP P PP P PP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPP 250 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P P Sbjct: 273 PPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P PP P PP Sbjct: 221 PLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPP 255 Score = 33.5 bits (73), Expect = 7.8 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +1 Query: 850 PPXPXP-SPXXXPXPXPPXXPXPXPP 924 PP P P SP P P PP P P PP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPP 243 >UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukaryota|Rep: Predicted membrane protein - Ostreococcus tauri Length = 1449 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P P+P P P PP P P P Sbjct: 811 PPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPP 870 Query: 922 P 924 P Sbjct: 871 P 871 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 797 PSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPP 829 Score = 40.7 bits (91), Expect = 0.052 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P PP P P+P P P PP P P P Sbjct: 823 PPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSP 882 Query: 922 P 924 P Sbjct: 883 P 883 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 803 PSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPP 835 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXP--PPXPXXXXXPPXXPXXXPP 925 P PP PPPP P PP P PP P PP Sbjct: 807 PPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPP 841 Score = 37.1 bits (82), Expect = 0.64 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP PPPP PPP P PP P P Sbjct: 863 PPAPTPPPPPSPPPSPPPSPPPPPSPPPPP 892 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P P P PP Sbjct: 876 PSPPPSP-PPPPSPPPPPSPPPSPSPPPSSNPP 907 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PPP PPP P P P PP Sbjct: 868 PPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPP 901 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P P Sbjct: 791 PPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTP 823 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P P Sbjct: 794 PLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSP 826 Score = 35.9 bits (79), Expect = 1.5 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP P P P PP P PP Sbjct: 860 PNPPPAPTPPPP-PSPPPSPPPSPPPPPSPPPP 891 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXP 922 P PP PPP P PPP P PP P P Sbjct: 854 PSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPP 886 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 787 PPPSPPPPLPPSPPPPPSPPPPPPPPSPPPP 817 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP PP Sbjct: 792 PPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPP 824 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP S P PP PPP P PP P P Sbjct: 872 PSPPPSPPPSPP-PPPSPPPPPSPPPSPSPPP 902 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 833 PPXSXXPPPPX-PPPXPXXXXXPPXXPXXXPP 925 PP S PPP PPP P PP P PP Sbjct: 918 PPLSSPPPPSSPPPPSPPLPPSPPLPPNPPPP 949 Score = 34.3 bits (75), Expect = 4.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP S PP P PP P PP P P Sbjct: 923 PPPPSSPPPPSPPLPPSPPLPPNPPPPPSPSP 954 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXP---PXXPXXXPP 925 PP PPPP PPP P P P P PP Sbjct: 851 PPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPP 884 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 43.2 bits (97), Expect = 0.010 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P P P P P PP P P P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Query: 922 P 924 P Sbjct: 690 P 690 Score = 42.7 bits (96), Expect = 0.013 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P P P P P PP P P P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Query: 922 P 924 P Sbjct: 693 P 693 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 674 PLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 41.1 bits (92), Expect = 0.039 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P PSP P P PP P P P Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP-PSPPPPPPPPPPPPPPPPP 695 Query: 922 P 924 P Sbjct: 696 P 696 Score = 40.3 bits (90), Expect = 0.068 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PPP P PP P PP Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPP 262 Score = 39.9 bits (89), Expect = 0.090 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P PP Sbjct: 680 PPPPPPPPPPPPPPPPPPPPPPPHPPPPSPP 710 Score = 39.5 bits (88), Expect = 0.12 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P P P P P PP P P Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPH 703 Query: 922 P 924 P Sbjct: 704 P 704 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVP 714 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 687 PPPPPPPPPPPPPPPPHPPPPSPPPLVPALPP 718 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 219 PLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPP 251 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPP 254 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPP 256 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 677 PSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSP 709 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 679 PPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 682 PPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVP 714 Score = 38.3 bits (85), Expect = 0.28 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 216 PPPPLPPSPPPPSPPP-PPPSPPPPLPPPPPPP 247 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P P P P P PP P Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALP 717 Query: 922 P 924 P Sbjct: 718 P 718 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PP P PP P PP Sbjct: 209 PPPPSPPPPPPLPPSPPPPSPPPPPPSPPPP 239 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP P P P PP P PP Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPP 246 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP P P P PP P PP Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPP 253 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P PP P P PP Sbjct: 210 PPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPP 242 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PP P PP P PP Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPP 259 Score = 34.3 bits (75), Expect = 4.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P PP P P PP Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPP 257 >UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear polyhedrosis virus|Rep: ORF1629 - Leucania separata nuclear polyhedrosis virus (LsNPV) Length = 589 Score = 42.7 bits (96), Expect = 0.013 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 244 PAPPPQPIPPPPPPPPMPVESGSPPPPPPPPPP 276 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P + PP P P P P PP P P PP Sbjct: 246 PPPQPIPPPPPPPPMPVESGSPPPPPPPPPPPP 278 Score = 33.5 bits (73), Expect = 7.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P S P P PP P P PP Sbjct: 250 PIPPPPPPPPMPVESGSPPPPPPPPPPPPPPPP 282 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 274 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPP 284 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPP 285 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 254 PPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 256 PPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLP 283 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 260 PPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLP 292 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P + PP P P P P P PP P P PP Sbjct: 227 PPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P + PP P P P P P PP P P PP Sbjct: 228 PQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP P PP PPP P PP P P Sbjct: 263 PPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLP 294 >UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi|Rep: formin-like 2 - Xenopus tropicalis Length = 1054 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 535 PPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPP 567 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 534 PPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPP 566 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 532 PSPPPPPPPPPPPPPPPP-----PPPLPSAEPP 559 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 218 PPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPP 250 Score = 41.9 bits (94), Expect = 0.022 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 209 PPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPP 241 Score = 41.1 bits (92), Expect = 0.039 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P P Sbjct: 2280 PTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSP 2312 Score = 39.9 bits (89), Expect = 0.090 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 2674 PSPPPS--PPPPSPPPSPPPSPPPPSPPPPSPP 2704 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 208 PPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPP 240 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 210 PPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPP 242 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 213 PLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPP 245 Score = 39.1 bits (87), Expect = 0.16 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPP--PPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP PP PPP P PP P PP Sbjct: 220 PPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPP 254 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 226 PPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPP 258 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 231 PPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTP 263 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 1173 PSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPP 1205 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 2543 PSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPP 2575 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 2548 PLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPP 2580 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 2552 PPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPP 2584 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 2691 PSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPP 2723 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 2696 PSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPP 2728 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 2745 PSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPP 2777 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PPP PPP P PP P PP Sbjct: 1182 PPPSPPPPPSPPPPSPPPPLPPPPSPPPPPP 1212 Score = 38.7 bits (86), Expect = 0.21 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P P P PSP P P P P P P Sbjct: 2670 PPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPP 2729 Query: 922 P 924 P Sbjct: 2730 P 2730 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 205 PPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPP 237 Score = 37.9 bits (84), Expect = 0.36 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXP-PPXPXXXXXPPXXPXXXPP 925 P PP PPPP P PP P PP P PP Sbjct: 224 PSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPP 257 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PPP P PP P P Sbjct: 1175 PPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSP 1207 Score = 37.9 bits (84), Expect = 0.36 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P PSP P P PP P P P Sbjct: 2254 PPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSP-PPPSPPPPSPPPPSP 2312 Query: 922 P 924 P Sbjct: 2313 P 2313 Score = 37.9 bits (84), Expect = 0.36 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPP-PPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP PP PPP P PP P PP Sbjct: 2275 PSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPP 2308 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PP P PP P PP Sbjct: 2687 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 2719 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PP P PP P PP Sbjct: 2711 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2743 Score = 37.1 bits (82), Expect = 0.64 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PP P PP P PP Sbjct: 2539 PSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPP 2571 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP PPP P PP P PP Sbjct: 2526 PCSPPS--PPPPSPPPSPPPSPPPPLPPPPSPP 2556 Score = 36.3 bits (80), Expect = 1.1 Identities = 21/69 (30%), Positives = 22/69 (31%) Frame = +1 Query: 718 GXLSSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXP 897 G +S PP P PP P P P P PSP P P P Sbjct: 197 GVVSDFPSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPP----PSPPPPSPPPPPPPSP 252 Query: 898 PXXPXPXPP 924 P P P P Sbjct: 253 PPPPPPPLP 261 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PP P PP P PP Sbjct: 217 PPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPP 249 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PP P PP P PP Sbjct: 223 PPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPP 255 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP PP P PP Sbjct: 2259 PPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPP 2291 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP P P P PP P PP Sbjct: 2267 PPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPP 2299 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 2668 PSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPP 2700 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P P Sbjct: 2700 PPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSP 2732 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PP P PP P PP Sbjct: 2701 PSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPP 2733 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PP P PP P PP Sbjct: 2706 PSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 2738 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 2715 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2747 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 2720 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2752 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 2725 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2757 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 2735 PSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSP 2767 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 2740 PSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPP 2772 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PP P PPP P PP P PP Sbjct: 2754 PPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPP 2786 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 2253 PPPSPPPPSPHPPSPPPPSPPPPSPPPPTPP 2283 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP PPP P PP P PP Sbjct: 2255 PSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPP 2287 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 2258 PPPSPHPPSPPPPSPPPPSPPPPTPPPSPPP 2288 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P P P P PP P PP Sbjct: 2273 PPPSPPPPTPPPSPPPPPPTPPPSPPPPSPP 2303 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP S PPPP PPP P PP P Sbjct: 2563 PSPPPS--PPPPSPPPSPPPPSPPPYPP 2588 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 2718 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2748 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 2723 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2753 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 2728 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2758 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 2733 PPPSPPPPSPPPPSPPPPSPPPPSPPPPLPP 2763 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 2738 PPPSPPPPSPPPPSPPPPSPPPPLPPAPSPP 2768 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP PP Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPP 235 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 2264 PPSPPPPSPPPPSPPP-PTPPPSPPPPPPTPPP 2295 Score = 35.1 bits (77), Expect = 2.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPX---PPPXPXXXXXPPXXPXXXPP 925 P PP S P PP PPP P PP P PP Sbjct: 2535 PSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPP 2570 Score = 35.1 bits (77), Expect = 2.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPX---PPPXPXXXXXPPXXPXXXPP 925 P PP S P PP PPP P PP P PP Sbjct: 2683 PSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPP 2718 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 2730 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLP 2762 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PPP PPP P P P PP Sbjct: 2272 PPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPP 2305 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PPP PPP PP P PP Sbjct: 2555 PPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYPP 2588 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP-PXPXXXXXPPXXPXXXPP 925 P P PPPP PP P P PP P PP Sbjct: 2749 PPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPP 2782 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPX-PPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 1184 PSPPPPPSPPPPSPPPPLPPPPSPPPPPPLPLIP 1217 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP--XPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 2532 PPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPP 2566 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P PSP P P P P P PP Sbjct: 2534 PPSPPPSPPPSPPPPLPPPPSPPPP 2558 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S P PP PPP P PP P PP Sbjct: 200 SDFPSPPPPPPPPPLPPPPPPPPPPSPP 227 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + P PP P P P P P PP Sbjct: 2287 PPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQPP 2319 >UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC0732; n=2; Xanthomonas|Rep: Putative uncharacterized protein XAC0732 - Xanthomonas axonopodis pv. citri Length = 266 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 233 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPFQPP 265 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFQP 264 >UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 1274 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 276 PPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPP 308 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 274 PPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPP 306 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 275 PPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPP 307 Score = 37.1 bits (82), Expect = 0.64 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P PP P P PP Sbjct: 278 PPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPP 310 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP PP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPSPPAPAPPPPP 302 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 272 PPPPPPPPPPPPPPPPPP-----PPSPPAPAPP 299 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 273 PPPPPPPPPPPPPPPPPPPSPPAPAPPPPPP 303 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP---PXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P P PP P PP Sbjct: 280 PPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPP 315 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP PP Sbjct: 277 PPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPP 309 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P P Sbjct: 285 PPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAP 317 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP P P P PP P P Sbjct: 290 PPSPPAPAPPPPPPAPPPPPPAPPPPAPVNNDP 322 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 1414 PPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPP 1446 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 1415 PPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPP 1447 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 1418 PPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 1419 PPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 1422 PPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 39.9 bits (89), Expect = 0.090 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P PP Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1439 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTP 1441 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 1416 PPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 1420 PPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPP 1452 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 1421 PPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 Score = 37.5 bits (83), Expect = 0.48 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P + PPPP PPP P PP P PP Sbjct: 1404 PTGTAPPPPPPPPPPPPPPPPPPPPPPPPPP 1434 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPP 518 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 492 PPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPP 524 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 41.5 bits (93), Expect = 0.030 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP S PPPP PPP P PP P P Sbjct: 507 PPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 Score = 41.1 bits (92), Expect = 0.039 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PP P PP P PP Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 40.3 bits (90), Expect = 0.068 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P P PP P P PP Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPP 522 Score = 40.3 bits (90), Expect = 0.068 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P P PP P P PP Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 530 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPP 519 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 488 PPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPP 520 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 491 PPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPP 523 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPP 526 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPP 528 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 529 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 506 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP P PP PPP P PP P P Sbjct: 503 PSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P P P P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPGPSPITPSVRP 545 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP PP P PP Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPP 527 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P P Sbjct: 509 PPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITP 541 >UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnoliophyta|Rep: Extensin protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 470 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 39.9 bits (89), Expect = 0.090 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PPPP PPP P PP P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PP P PP P PP Sbjct: 404 PPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPP 436 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P P Sbjct: 403 PPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYP 435 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPP PPP P PP P PP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPP 402 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 242 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 244 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 254 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 233 PPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPP 265 Score = 41.1 bits (92), Expect = 0.039 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP PP P PP Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 243 Score = 41.1 bits (92), Expect = 0.039 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP PP P PP Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 255 Score = 41.1 bits (92), Expect = 0.039 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP PP P PP Sbjct: 235 PPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPP 267 Score = 41.1 bits (92), Expect = 0.039 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP P P P PP P PP Sbjct: 256 PPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPP 288 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 235 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 238 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 239 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 209 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 241 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 247 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 218 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 250 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 251 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 221 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 227 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 259 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 234 PPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPP 266 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 236 PPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPP 268 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 242 PPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPP 274 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 245 PPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPP 277 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 251 PSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPP 283 Score = 38.7 bits (86), Expect = 0.21 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPP-XXPXPX 918 PP P PP P P PP P P P P P PP P P Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPP 276 Query: 919 PP 924 PP Sbjct: 277 PP 278 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP P P P P P PP Sbjct: 247 PPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPP 279 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 230 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP P PP PPP P PP P P Sbjct: 231 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 237 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP P P P PP P PP Sbjct: 214 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 246 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 249 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP P P P PP P PP Sbjct: 226 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 258 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P P Sbjct: 230 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 232 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSP 264 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 241 PPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSP 273 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP PP Sbjct: 243 PPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPP 275 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP PP P PP Sbjct: 244 PPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPP 276 Score = 35.5 bits (78), Expect = 1.9 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPX-XXPXPXPPXXPXPX 918 PP P PP P P P P P P P P PP P P Sbjct: 226 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPA 285 Query: 919 PP 924 PP Sbjct: 286 PP 287 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 832 PXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P + P P P P P P PP P P PP Sbjct: 196 PQNIVVEPQPPPPPPPPPPPSPPPPPPPPPP 226 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 239 PRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPP 271 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 245 PMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 277 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 39.9 bits (89), Expect = 0.090 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P PP Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPPP 272 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPP 273 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPP 274 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P PP P PP Sbjct: 251 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPP 283 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 259 PPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKP 291 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 243 PPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 275 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 244 PPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 276 Score = 37.5 bits (83), Expect = 0.48 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P PSP P P PP P P PP Sbjct: 224 PPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPP 256 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXP-PXXPXXXP 922 P PP S PPPP PPP P P P P P Sbjct: 260 PPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPP 292 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PPP P PP P P Sbjct: 255 PPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPP 286 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP PPP P PP P PP Sbjct: 235 PSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPP 267 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P P PP PPP P PP P PP Sbjct: 237 PSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPP 269 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP PP Sbjct: 254 PPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPP 286 Score = 34.7 bits (76), Expect = 3.4 Identities = 21/74 (28%), Positives = 21/74 (28%) Frame = +1 Query: 703 PXARCGXLSSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXX 882 P R SS PP PP P P PP P P P Sbjct: 212 PAVRRPPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPP 271 Query: 883 PXPXPPXXPXPXPP 924 P P PP P P Sbjct: 272 PPPPPPPPLLPPLP 285 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PP P PP P Sbjct: 268 PPPPPPPPPPPPLLPPLPPFPAKPPMSP 295 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 231 PPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPP 263 Score = 41.1 bits (92), Expect = 0.039 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP PP P PP Sbjct: 221 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 253 Score = 39.9 bits (89), Expect = 0.090 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP P PPP P PP P PP Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPP 242 Score = 39.9 bits (89), Expect = 0.090 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP P PPP P PP P PP Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPP 248 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 208 PPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPP 240 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 219 PSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 251 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 228 PPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 39.1 bits (87), Expect = 0.16 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP--XPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 233 PPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPP 267 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PP P PPP P PP P PP Sbjct: 206 PPPPPPPPSPSPPPSPPPPPSPPPPPPPPPP 236 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 230 PPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSP 262 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P PP P P PP Sbjct: 213 PSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPP 245 Score = 34.7 bits (76), Expect = 3.4 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXP--XP 915 PP P PP P P PP P P P P PP P P Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIP 270 Query: 916 XPP 924 PP Sbjct: 271 SPP 273 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PP P PP P Sbjct: 243 PPPPPPPSPPPPPSPPPPSPPLPPPSIP 270 Score = 34.3 bits (75), Expect = 4.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P P P PSP P P PP P P P Sbjct: 206 PPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPP 237 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 223 PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 255 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 258 Score = 40.3 bits (90), Expect = 0.068 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P P PP P P PP Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 260 Score = 39.9 bits (89), Expect = 0.090 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXP-PXXPXXXPP 925 P PP S PPPP PPP P P P P PP Sbjct: 237 PPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPP 270 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 236 PPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 257 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 230 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 262 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPP 263 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 235 PPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 240 PPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPP 272 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P S PPPP PPP P PP P PP Sbjct: 219 PVASPSPPPPPPPPPPPPPPPPPSPPPPPPP 249 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PP P PP P P Sbjct: 248 PPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTP 279 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP PP Sbjct: 239 PPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPP 271 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P S PPPP PPP P P P PP Sbjct: 219 PVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPP 251 >UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C5 protein precursor - Chlamydomonas reinhardtii Length = 541 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 196 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 228 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 207 Score = 39.1 bits (87), Expect = 0.16 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 177 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPP 211 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 183 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 215 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 188 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 220 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 201 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 233 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 210 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 242 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 215 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 247 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 224 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 256 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PP P P P PP Sbjct: 203 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 235 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PP P PP P PP Sbjct: 211 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 243 Score = 37.1 bits (82), Expect = 0.64 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P PSP P P PP P P PP Sbjct: 186 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 218 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P P PP P P PP Sbjct: 194 PSPPPPSPPPPPPPSPPPPPPPSPP-PPSPPPP 225 Score = 35.9 bits (79), Expect = 1.5 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPP--PPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP PP PP P PP P PP Sbjct: 185 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 219 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP PP P PP Sbjct: 191 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPP 223 Score = 35.9 bits (79), Expect = 1.5 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPX--PXPSPXXXPXPXPPXXPXP 915 PP P PP P P PP P PSP P P PP P P Sbjct: 192 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP-PPSP 250 Query: 916 XPP 924 PP Sbjct: 251 PPP 253 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P P P PP Sbjct: 202 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 234 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP PP P PP Sbjct: 214 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 246 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP PP P PP Sbjct: 219 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 251 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 220 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 252 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 225 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 257 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 218 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PPP P P P PP Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXP-PPXPXXXXXPPXXPXXXPP 925 P PP P PP P PP P PP P PP Sbjct: 181 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 214 >UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|Rep: H0315A08.9 protein - Oryza sativa (Rice) Length = 168 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 >UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein; n=2; Dictyostelium discoideum|Rep: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein - Dictyostelium discoideum (Slime mold) Length = 243 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 39.9 bits (89), Expect = 0.090 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P PP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P P PP P P PP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 >UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 283 PPPPPPPPPPPPPPPPPPKGVPPPPRGPPPPPP 315 >UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 349 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPSLLPP 93 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPSLLP 92 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P PP P PP Sbjct: 55 SPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 832 PXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P P P PP P P PP Sbjct: 49 PQTFMASPPPPPPPPPPPPPPPPPPPPPPPP 79 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 139 PPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPP 171 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 133 PGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPP 165 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 141 PPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHP 173 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 142 PPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPP 174 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PP P PP P PP Sbjct: 162 PPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPP 194 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P PP Sbjct: 143 PPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPP 175 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P L PP P P P P PP P P P Sbjct: 127 PPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPP 158 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPX-PPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 209 PAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPP 242 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PP P PP PP Sbjct: 218 PPPKGPPPPPHSPPGPPPAEGPPPPAKVPPP 248 Score = 33.9 bits (74), Expect = 5.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP P P PP P PP Sbjct: 224 PPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPP 256 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 147 PPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPP 181 Score = 33.5 bits (73), Expect = 7.8 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPP--XPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP PPP P PP P PP Sbjct: 231 PGPPPAEGPPPPAKVPPPAPPVEGPPP--PHSPPP 263 >UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n=1; Owenia fusiformis|Rep: Uncharacterized proline-rich protein - Owenia fusiformis Length = 141 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P PP P PP Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 841 LXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 L PP P P P P P PP P P PP Sbjct: 7 LTPPPPPPPPPPPPPPPPPPPPPPPPPP 34 >UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precursor; n=1; Volvox carteri|Rep: Sulfated surface glycoprotein 185 precursor - Volvox carteri Length = 485 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 258 PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 290 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 41.9 bits (94), Expect = 0.022 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PPPP PPP P PP P PP Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 41.1 bits (92), Expect = 0.039 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P P P PP Sbjct: 272 PPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPP 304 Score = 40.3 bits (90), Expect = 0.068 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P P PP P P PP Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 251 PSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPP 283 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPP 285 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 255 PPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 256 PSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 265 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 297 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 300 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 276 PSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSP 308 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 280 PPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPP 312 Score = 37.9 bits (84), Expect = 0.36 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 1/66 (1%) Frame = +1 Query: 730 SXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPS-PXXXPXPXPPXX 906 S P P PP P P PP P PS P P P PP Sbjct: 252 SPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVP 311 Query: 907 PXPXPP 924 P P PP Sbjct: 312 PPPSPP 317 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP PPP P P P PP Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPP 286 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PPP P PP P PP Sbjct: 242 PSPPPSPRPPSP-PPPSPSPPPPPPPPPPPPPP 273 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 279 PPPPPPPPPPPPPPPPPSPSPPRKPPSPSPP 309 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P P PPP P PP P PP Sbjct: 248 PRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPP 280 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P P Sbjct: 267 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSP 299 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P P P PP Sbjct: 282 PPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPP 314 Score = 34.3 bits (75), Expect = 4.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P P P P PP Sbjct: 233 PQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPP 265 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 245 PPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPP 279 >UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Human herpesvirus 4|Rep: Epstein-Barr nuclear antigen 2 - Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Length = 487 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPP 93 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 95 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 42.3 bits (95), Expect = 0.017 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPP 91 >UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 661 Score = 41.9 bits (94), Expect = 0.022 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PPPP PPP P PP P PP Sbjct: 481 PPSSPSPPPPPPPPPPPRPPPPPPPPSQPPP 511 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPRVSTP-APTYLPP 109 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P P PPPP PPP P PP P Sbjct: 482 PSSPSPPPPPPPPPPPRPPPPPPPPSQP 509 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP PPPP PPP P PP P Sbjct: 488 PPPPPPPPPPRPPPPPPPPSQPPPTSLTPP 517 >UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 1065 Score = 41.9 bits (94), Expect = 0.022 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P PSP P P PP P P P Sbjct: 485 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSP 544 Query: 922 P 924 P Sbjct: 545 P 545 Score = 41.9 bits (94), Expect = 0.022 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P PSP P P PP P P P Sbjct: 489 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSP 548 Query: 922 P 924 P Sbjct: 549 P 549 Score = 40.3 bits (90), Expect = 0.068 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P PSP P P PP P P P Sbjct: 518 PPSPPSPPPSPPPSPPPSPPPSPPPSPPPSP-----PPSPPPSPPPSPPPSPPPSPPPSP 572 Query: 922 P 924 P Sbjct: 573 P 573 Score = 38.7 bits (86), Expect = 0.21 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P PSP P P PP P P P Sbjct: 494 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPP-SPPPSPPPSPPPSPPPSPPPSPPPSP 552 Query: 922 P 924 P Sbjct: 553 P 553 Score = 38.7 bits (86), Expect = 0.21 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P PSP P P PP P P P Sbjct: 498 PPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPP-SPPPSPPPSPPPSPPPSPPPSPPPSP 556 Query: 922 P 924 P Sbjct: 557 P 557 Score = 38.7 bits (86), Expect = 0.21 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P PSP P P PP P P P Sbjct: 502 PPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPP-SPPPSPPPSPPPSPPPSPPPSPPPSP 560 Query: 922 P 924 P Sbjct: 561 P 561 Score = 38.7 bits (86), Expect = 0.21 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P PSP P P PP P P P Sbjct: 506 PPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPP-SPPPSPPPSPPPSPPPSPPPSPPPSP 564 Query: 922 P 924 P Sbjct: 565 P 565 Score = 38.7 bits (86), Expect = 0.21 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P PSP P P PP P P P Sbjct: 510 PPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPP-SPPPSPPPSPPPSPPPSPPPSPPPSP 568 Query: 922 P 924 P Sbjct: 569 P 569 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P PSP P P PP P P PP Sbjct: 482 PPSPPPSPPPSPPPSPPPSPPPSPP 506 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P PSP P P PP P P PP Sbjct: 469 PTPTPTPTPTPSPPPSPPPSPPPSPPPSPPPSPP 502 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PPP PPP P P P PP Sbjct: 542 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPP 575 Score = 35.9 bits (79), Expect = 1.5 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PPP PPP P PP P PP Sbjct: 479 PSPPPSPPPSPPPSPPPSP-PPSPPPSPPPSPPP 511 Score = 35.9 bits (79), Expect = 1.5 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PPP PPP P PP P PP Sbjct: 483 PSPPPSPPPSPPPSPPPSP-PPSPPPSPPPSPPP 515 >UniRef50_A4S1A8 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 388 Score = 41.1 bits (92), Expect = 0.039 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +1 Query: 715 CGXLSSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPX 894 CG PP P P P PP P PSP P P Sbjct: 82 CGVSVCPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPN 141 Query: 895 PPXXPXPXPP 924 PP P P PP Sbjct: 142 PPPSPPPSPP 151 Score = 38.7 bits (86), Expect = 0.21 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P PP P PSP P P PP P P P Sbjct: 96 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP-SPPPSPPPSPPPNPPPSPPPSPPPSP 154 Query: 922 P 924 P Sbjct: 155 P 155 Score = 38.7 bits (86), Expect = 0.21 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P PP P PSP P P PP P P P Sbjct: 104 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP-SPPPNPPPSPPPSPPPSPPPSPPPSP 162 Query: 922 P 924 P Sbjct: 163 P 163 Score = 38.7 bits (86), Expect = 0.21 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P PP P PSP P P PP P P P Sbjct: 108 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP-NPPPSPPPSPPPSPPPSPPPSPPPSP 166 Query: 922 P 924 P Sbjct: 167 P 167 >UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 430 Score = 40.7 bits (91), Expect = 0.052 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP PPP P PP P PP Sbjct: 178 PPPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPP 210 Score = 37.1 bits (82), Expect = 0.64 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P PSP P P PP P P PP Sbjct: 147 PPPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPP 179 Score = 35.5 bits (78), Expect = 1.9 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +1 Query: 745 PXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXX-PXPXPPXXPXPXP 921 P P PP P P + PP P PSP P P PP P P P Sbjct: 99 PPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSPPPP-PSPFAPEPSPPPPMPPPPTP 157 Query: 922 P 924 P Sbjct: 158 P 158 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PP P PP P PP Sbjct: 191 PPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSPP 223 Score = 33.9 bits (74), Expect = 5.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PP P PP P PP Sbjct: 157 PPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPP 189 Score = 33.9 bits (74), Expect = 5.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PP PP PP P PP Sbjct: 168 PPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPP 200 Score = 33.5 bits (73), Expect = 7.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PP P PPP PP P PP Sbjct: 91 PRSPPSPSPPSPSPPPSFPPSVPPPSNPPNVPP 123 >UniRef50_Q06KR7 Cluster: Viral capsid associated protein; n=3; Nucleopolyhedrovirus|Rep: Viral capsid associated protein - Anticarsia gemmatalis nuclear polyhedrosis virus (AgMNPV) Length = 643 Score = 40.7 bits (91), Expect = 0.052 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP + PPPP PPP P PP P PP Sbjct: 357 PPPNVMPPPPPPPPPPPPNMPPPNMPPPPPP 387 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 358 PPNVMPPPPPPPPPPPPNMPPPNMPPPPPPP 388 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXP---PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + P PPP PPP P PP PP Sbjct: 351 PPPPVAPPPNVMPPPPPPPPPPPPNMPPPNMPPPPP 386 >UniRef50_Q013M1 Cluster: Chromosome 08 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 08 contig 1, DNA sequence - Ostreococcus tauri Length = 442 Score = 40.7 bits (91), Expect = 0.052 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P P PP P P PP Sbjct: 157 PSPPLSPPPPSPPPSPPPNPPPNPPPNPPPNPP 189 Score = 36.7 bits (81), Expect = 0.84 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P PP P P PP Sbjct: 169 PPSPPPNPPPNPPPNPPPNPPPSPP 193 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PPP P PP P PP Sbjct: 190 PSPPPSLSPPNP-PPPSPSPPPSPPPSPPPSPP 221 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 163 PPPPSPPPSPPPNPPPNP-PPNPPPNPPPSPPP 194 Score = 34.7 bits (76), Expect = 3.4 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P PP P PSP P P PP P P Sbjct: 165 PPSPPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPPPSPPPSL 224 Query: 922 P 924 P Sbjct: 225 P 225 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 199 PNPPPPSPSPPPSPPPSP-----PPSPPPSLPP 226 >UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=58; Pneumocystis carinii|Rep: Protease-1 (PRT1) protein, putative - Pneumocystis carinii Length = 947 Score = 40.7 bits (91), Expect = 0.052 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P P P P P PP P P P Sbjct: 763 PPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPP 822 Query: 922 P 924 P Sbjct: 823 P 823 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + P PP PPP P PP P P Sbjct: 750 PSPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAP 782 Score = 34.7 bits (76), Expect = 3.4 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P P P P+P P P PP P P Sbjct: 765 PPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPPPR 824 Query: 922 P 924 P Sbjct: 825 P 825 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P+P P P PP P P PP Sbjct: 758 PAPPAPPPPPAPAPAP---PAPPPPPAPAPAPP 787 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P + PPPP PPP P P P P Sbjct: 806 PAPAPAPAPPPPPPPPPPRPELEPEPEPEPEP 837 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P + PPPP PPP P P P P Sbjct: 808 PAPAPAPPPPPPPPPPRPELEPEPEPEPEPEP 839 >UniRef50_Q00TR5 Cluster: Homology to unknown gene; n=3; Ostreococcus|Rep: Homology to unknown gene - Ostreococcus tauri Length = 1931 Score = 40.3 bits (90), Expect = 0.068 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 1/70 (1%) Frame = +1 Query: 718 GXLSSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPS-PXXXPXPX 894 G SS P P PP P P PP P PS P P P Sbjct: 1799 GPASSWHKIPPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPPPS 1858 Query: 895 PPXXPXPXPP 924 PP P P PP Sbjct: 1859 PPPSPPPSPP 1868 Score = 39.9 bits (89), Expect = 0.090 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PPP PPP P PP P PP Sbjct: 1815 PSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPP 1848 Score = 39.9 bits (89), Expect = 0.090 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PPP PPP P PP P PP Sbjct: 1819 PSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPP 1852 Score = 39.1 bits (87), Expect = 0.16 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPP--PPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP PP PPP P PP P PP Sbjct: 1831 PSPPPSPPPPSPPPSPPPSPPPSPPPPSPPPSPPP 1865 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 1837 PPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPP 1869 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PP PP P PP P PP Sbjct: 1823 PSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPP 1855 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PPP PPP P P P PP Sbjct: 1811 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPP 1844 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 1808 PPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPP 1840 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PP P P P PP P P Sbjct: 1827 PSPPPSPPPSPPPPSPPPSPPPSPPPSPPPPSP 1859 >UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.220; n=1; Neurospora crassa|Rep: Putative uncharacterized protein 15E6.220 - Neurospora crassa Length = 1992 Score = 40.3 bits (90), Expect = 0.068 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP + PPPP PPP P PP P P Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPPPEPEP 77 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEP 77 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 827 PXPPXSXXPPPPX-PPPXPXXXXXPPXXPXXXP 922 P PP S PPPP PPP P PP P P Sbjct: 47 PPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQP 79 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PPP P PP P PP Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPP PPP P PP P P Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPPPEP 75 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P P P P Sbjct: 56 PPPPPPPPPPPPPPPPPPEPEPQPAPPPPETP 87 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P P P PP Sbjct: 50 PASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P P Sbjct: 55 PPPPPPPPPPPPPPPPPPPEPEPQPAPPPPETP 87 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P PP P P Sbjct: 60 PPPPPPPPPPPPPPEPEPQPAPPPPETPSQSQP 92 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P P Sbjct: 1943 PRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAP 1975 Score = 35.5 bits (78), Expect = 1.9 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP + PPPP PPP PP P Sbjct: 1955 PPPPPTEDPPPPPPPPPAEAPPPPPPTP 1982 Score = 35.1 bits (77), Expect = 2.6 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P P + PPPP PPP P PP P Sbjct: 1942 PPRPPTLAPPPPPPPPPPTEDPPPPPPP 1969 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PP PPP P PP P PP Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPPPPP 73 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPEPEPQPAPPP 83 >UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|Rep: OmpA family protein - Caulobacter crescentus (Caulobacter vibrioides) Length = 449 Score = 39.9 bits (89), Expect = 0.090 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P PP P PP Sbjct: 305 SPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPP PPP P PP P PP Sbjct: 302 SFASPPPPPPPPPPPPPPPPPPPPPPPP 329 >UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burkholderia|Rep: Hemagglutinin domain protein - Burkholderia mallei (Pseudomonas mallei) Length = 373 Score = 39.9 bits (89), Expect = 0.090 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P PP Sbjct: 90 PPPPPPPPPPPPPPPPPPSPPPPSPPPPSPP 120 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 90 PPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPP 122 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 92 PPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSP 124 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 93 PPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPP 125 Score = 37.5 bits (83), Expect = 0.48 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PPPP PPP P PP P PP Sbjct: 86 PNKVPPPPPPPPPPPPPPPPPPSPPPPSPP 115 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P P P PP Sbjct: 94 PPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPP 126 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P P P PP Sbjct: 95 PPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPP 127 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 97 PPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 129 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PP P PP P PP Sbjct: 98 PPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 130 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 101 PPPPPPPSPPPPSPPP-PSPPPPSPPPPSPPPP 132 >UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region; n=1; Caulobacter sp. K31|Rep: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region - Caulobacter sp. K31 Length = 608 Score = 39.9 bits (89), Expect = 0.090 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPVETSP 503 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P PP P PP Sbjct: 467 SPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 >UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thaliana|Rep: F14J22.4 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 494 Score = 39.9 bits (89), Expect = 0.090 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP P PP P PP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPP 86 Score = 39.5 bits (88), Expect = 0.12 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P PSP P PP P P P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAP 105 Query: 922 P 924 P Sbjct: 106 P 106 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLP 95 >UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP4 protein - Volvox carteri f. nagariensis Length = 1143 Score = 39.9 bits (89), Expect = 0.090 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP P PPP P PP P PP Sbjct: 525 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 558 Score = 39.9 bits (89), Expect = 0.090 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP P PPP P PP P PP Sbjct: 531 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 564 Score = 39.9 bits (89), Expect = 0.090 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP P PPP P PP P PP Sbjct: 537 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 570 Score = 39.9 bits (89), Expect = 0.090 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP P PPP P PP P PP Sbjct: 543 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 576 Score = 39.9 bits (89), Expect = 0.090 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP P PPP P PP P PP Sbjct: 549 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 582 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 520 PSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 552 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P P P PP Sbjct: 567 PPPPPSP-PPPPSPPPPPSPRHPPSPPPRPRPP 598 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP P PPP P PP P P Sbjct: 555 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHP 588 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P P P PP Sbjct: 518 PRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 550 Score = 35.9 bits (79), Expect = 1.5 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXP--XP 915 PP P PP P P PP P PSP P P PP P P Sbjct: 531 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP-PSPPPPPSPPPPPSPRHPP 589 Query: 916 XPP 924 PP Sbjct: 590 SPP 592 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P P Sbjct: 553 PSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 585 Score = 35.9 bits (79), Expect = 1.5 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXP-PXXPXXXPP 925 P PP S PPPP PPP P P P P PP Sbjct: 561 PPPPPS-PPPPPSPPPPPSPPPPPSPRHPPSPPP 593 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P P Sbjct: 565 PSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRP 597 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 515 PRPPRPSPPSPP-PPPSPPPPPSPPPPPSPPPP 546 >UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family; n=2; Ostreococcus tauri|Rep: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family - Ostreococcus tauri Length = 872 Score = 39.9 bits (89), Expect = 0.090 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 509 PSPPPS--PPPPSPPPSPPPSPPPPSPPSPPPP 539 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 566 PPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPP 598 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 572 PSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPP 604 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PPP P PP P PP Sbjct: 496 PPVSSPPPSPSPPPSPPPSPPPPSPPPSPPP 526 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPP PPP P PP P P Sbjct: 562 PSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPP 593 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PP P PP P PP Sbjct: 569 PPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPP 601 Score = 35.5 bits (78), Expect = 1.9 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +1 Query: 715 CGXLSSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPX 894 C LSS PP P P P P PSP P P Sbjct: 481 CTLLSSVPSSELPTAPPVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPS 540 Query: 895 PPXXPXPXPP 924 P P P PP Sbjct: 541 PSPPPSPPPP 550 Score = 35.5 bits (78), Expect = 1.9 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P P P PSP P P P P P P Sbjct: 537 PPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSP-PPPSPPPPSPPPPPSPPPSPPPPPSP 595 Query: 922 P 924 P Sbjct: 596 P 596 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PP P P P PP Sbjct: 522 PSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPP 554 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PP P PPP P PP PP Sbjct: 530 PPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPP 562 >UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 4076 Score = 39.9 bits (89), Expect = 0.090 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP P PPP P PP P PP Sbjct: 88 PPPPPSPPPPPSPPPPPSPPPPSPPPSPPPPSPP 121 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PPP PPP P PP P PP Sbjct: 1869 PPPSPPPPPSPPPPSPPPPSPPPPSPPPPPP 1899 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PP P PP P PP Sbjct: 2094 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2126 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP--XPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 2087 PSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPP 2121 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP-PXPXXXXXPPXXPXXXPP 925 P PP S PP P PP P P PP P PP Sbjct: 2078 PSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPP 2111 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P P PP P P PP Sbjct: 85 PPSPPPPPSPPPPPSPPPPPSPPPP 109 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP PP Sbjct: 92 PSPPPPPSPPPPPSPPPPSPPPSPPPPSPPPPP 124 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P P P PP Sbjct: 2081 PPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPP 2113 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PP P PP P PP Sbjct: 2084 PPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPP 2116 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S P PP P P P PP P PP Sbjct: 2076 PPPSPPPSPPPPSPPPPSPPPPPSPPPPSPP 2106 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P P P P PP P P PP Sbjct: 2071 PPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPP 2103 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P P P P P PP Sbjct: 2076 PPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPP 2108 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PPPP PPP P P P PP Sbjct: 84 PPPSP-PPPPSPPPPPSPPPPPSPPPPSPPP 113 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP PP P Sbjct: 1871 PSPPPPPSPPPPSPPPPSPPPPSPPPPP 1898 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP S PPPP PPP P PP P P Sbjct: 2071 PPPS--PPPPSPPPSPPPPSPPPPSPPPPP 2098 >UniRef50_Q752A6 Cluster: AFR669Wp; n=1; Eremothecium gossypii|Rep: AFR669Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 1918 Score = 29.9 bits (64), Expect(2) = 0.12 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXP 880 PP PPPP PPP P Sbjct: 1250 PPPPPPPPPPPPPPIP 1265 Score = 29.5 bits (63), Expect(2) = 0.43 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPP 901 PPPP PPP P PP Sbjct: 1289 PPPPPPPPPPPPPPPPP 1305 Score = 28.7 bits (61), Expect(2) = 0.12 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 854 PPPXPPPXPXXXXXPPXXP 910 PPP PPP P PP P Sbjct: 1289 PPPPPPPPPPPPPPPPPLP 1307 Score = 27.1 bits (57), Expect(2) = 0.43 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP 871 P PP PPPP PP Sbjct: 1252 PPPPPPPPPPPPIPP 1266 Score = 26.6 bits (56), Expect(2) = 6.0 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXP 898 PPPP PPP P P Sbjct: 1292 PPPPPPPPPPPPPPLP 1307 Score = 25.8 bits (54), Expect(2) = 6.0 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P PP PPPP PP Sbjct: 1251 PPPPPPPPPPPPPIPP 1266 >UniRef50_UPI00015BDD6A Cluster: UPI00015BDD6A related cluster; n=1; unknown|Rep: UPI00015BDD6A UniRef100 entry - unknown Length = 231 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 68 PPPPPPPPPPPPPPPPPPPETPPPPPPPVSKP 99 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPETPPPPPPPVSKP 99 Score = 37.5 bits (83), Expect = 0.48 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 65 PAPPP---PPPPPPPPPPPPPPPPPETPPPPPP 94 >UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucleopolyhedrovirus|Rep: 1629capsid - Hyphantria cunea nuclear polyhedrosis virus (HcNPV) Length = 539 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP PP P PP P PP Sbjct: 246 PPPPPNMPPPPPPPPNMPPPPPPPPPPPLSLPP 278 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 240 PPPPTPPPPPPNMPPPPPPPPNMPPPPPPPPPP 272 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +2 Query: 833 PPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 PP + PPPP PPP P PP P PP Sbjct: 241 PPPTPPPPPPNMPPPPPPPPNMPPPPPPPPPPP 273 >UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: All3916 protein - Anabaena sp. (strain PCC 7120) Length = 383 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 333 PDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPP 364 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PPPP PPP P P P PP Sbjct: 313 PPPSDPPPPPDPPPPPDPPPPDPPPPDPPPP 343 Score = 37.9 bits (84), Expect = 0.36 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPX-PPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 322 PDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPP 355 Score = 37.9 bits (84), Expect = 0.36 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP P PPP P PP P PP Sbjct: 328 PDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPP 361 Score = 37.9 bits (84), Expect = 0.36 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP-PXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P P PP P PP Sbjct: 344 PDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPP 377 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 347 PPPPDPPPPPPPDPPPPPDPPPPDRPPPPPPEPPP 381 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP PP P PP Sbjct: 319 PPPPDPPPPPDPPPPDPPPPDPPPPPDPPPP 349 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP PP Sbjct: 318 PPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPP 350 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PP P PP P P Sbjct: 352 PPPPPPPDPPPPPDPPPPDRPPPPPPEPPPPP 383 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P P P PP Sbjct: 310 PDPPPPSDPPPPPDPPPPPDPPPPDPPPPDPPP 342 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP P P P PP P PP Sbjct: 325 PPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPP 357 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PP P PP P PP Sbjct: 330 PPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPP 362 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P P P PP Sbjct: 335 PPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPP 367 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 340 PPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRP 372 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P P P PP Sbjct: 341 PPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPP 373 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PP P PP P PP Sbjct: 350 PDPPPPPPPDPPPPPDPPPPDRPPPPPPEPPPP 382 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXP 922 P PP PPP P PPP P PP P P Sbjct: 312 PPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPP 344 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P P P P PP P P PP Sbjct: 331 PPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPP 363 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 327 PPDPPPPDPPPPDPPP-PPDPPPPPDPPPPPPP 358 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P PP P PP Sbjct: 338 PDPPPPPDPPPP-PDPPPPPPPDPPPPPDPPPP 369 >UniRef50_Q2RTE8 Cluster: Putative uncharacterized protein; n=1; Rhodospirillum rubrum ATCC 11170|Rep: Putative uncharacterized protein - Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) Length = 208 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 85 PIPEPEPEPPPPPPPPPPPPPPPPPPPPPEPPP 117 >UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Rickettsia bellii|Rep: Cell surface antigen Sca2-6 - Rickettsia bellii Length = 909 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPTPPPPPLPKTPP 77 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPPPLPKTP 76 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPTPPPPPLPKTPP 77 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PP P PP P Sbjct: 53 PPPPPPPPPPPPPTPPPPPLPKTPPVDP 80 >UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome chr16 scaffold_94, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 341 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 43 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 >UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 603 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 383 PPPPPPPPPPPPPPPPPPAGKAPPPPIPPPPP 414 Score = 37.5 bits (83), Expect = 0.48 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP--XXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 397 PPPPAGKAPPPPIPPPPPGFKSMKAPPPPPPPPPP 431 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 383 PPPPPPPPPPPPPPPPPPAGKAPPPPIPPPP 413 >UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas vaginalis G3|Rep: Diaphanous, putative - Trichomonas vaginalis G3 Length = 620 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 536 PPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPP 568 Score = 37.5 bits (83), Expect = 0.48 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP P P PP P PP Sbjct: 100 PPPPKSDAPPPPPARPPPPPPTAPPATPPPPPP 132 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P +P P P PP P P PP Sbjct: 108 PPPPPARPPPPPPTAPPATPPPPPPNHPPPPPP 140 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPP PPP P PP P P Sbjct: 535 PPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAP 567 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP PPP P PP P PP Sbjct: 85 PPAPAPAAPPPARPPPPPPKSDAPPPPPARPPP 117 >UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_77, whole genome shotgun sequence - Paramecium tetraurelia Length = 1215 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 665 PPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPP 697 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP P PP Sbjct: 642 PPPPPPPPLPNTQVPPPPPPPPPPP 666 Score = 35.5 bits (78), Expect = 1.9 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P P + PPPP PPP P PP P Sbjct: 680 PPPSRNGAPPPPPPPPPPSKTGAPPPPP 707 Score = 34.3 bits (75), Expect = 4.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP PPP P P P PP Sbjct: 664 PPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPP 696 >UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 493 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 372 PPPPKGAPPPPPPPPPPPPPPGPPPPGQLPPPP 404 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 371 PPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPPP 403 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P PP P PP Sbjct: 362 SAPPPPPPPPPPPPKGAPPPPPPPPPPP 389 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PP P PP P PP Sbjct: 365 PPPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPP 397 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P PP P PP Sbjct: 364 PPPPPPPPPPPPKGAPPPPPPPPPPPPPPGPPP 396 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 370 PPPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPP 402 >UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1; Solanum tuberosum|Rep: Chitin-binding lectin 1 precursor - Solanum tuberosum (Potato) Length = 323 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 161 PPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSP 192 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 153 PPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPP 185 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 174 PPPPPPPSPPPPSPPPPSPSPPPPPASPPPPPP 206 Score = 37.9 bits (84), Expect = 0.36 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PPP PPP P PP P PP Sbjct: 164 PSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPP 197 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP--XPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 169 PPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASPPP 203 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPP-PPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP PP PPP PP P PP Sbjct: 155 PPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPP 188 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PP P PP P PP Sbjct: 152 PPPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPP 184 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 150 PSPPPP--PPPPSPPPPSPPSPPPPSPPPPPPP 180 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PP P PPP P P P PP Sbjct: 163 PPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPP 195 >UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG33556-PA - Strongylocentrotus purpuratus Length = 1472 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 458 PPPGMGGAPPPPPPPPFPGGVPPPPPLPGGAPP 490 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 481 PPPLPGGAPPPPPPPPFPGGGVPPPPFPGGGPP 513 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P + PPPP PPP P PP P PP Sbjct: 416 PAAAPPPPPPPPPLPPGVGAPPPPPPPPPP 445 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P PP Sbjct: 428 PLPPGVGAPPPPPPPPPPPLPGGSCIPPPPPPP 460 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P + PPPP PP P PP P PP Sbjct: 416 PAAAPPPPPPPPPLPPGVGAPPPPPPPPPPP 446 >UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 579 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 366 PPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPP 397 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPP PPP P PP P PP Sbjct: 380 PPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPP 412 Score = 33.9 bits (74), Expect = 5.9 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P P P P P PP P P Sbjct: 361 PPPPPPPPPGFLGPPPPPPPPLPGNTGAPPP-----PPPPPPLPGGGPPPPPPPPPPPGL 415 Query: 922 P 924 P Sbjct: 416 P 416 >UniRef50_Q9Q5L3 Cluster: EBNA-2; n=2; Cercopithecine herpesvirus 15|Rep: EBNA-2 - Cercopithecine herpesvirus 15 (Rhesus lymphocryptovirus) Length = 605 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 62 PGAPPPPPPPPPLPPPPPPPLPPPPPPPVQPPP 94 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 832 PXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P + P P P P P P PP P P PP Sbjct: 58 PQTVPGAPPPPPPPPPLPPPPPPPLPPPPPP 88 >UniRef50_Q4KT78 Cluster: ORF1629; n=2; Nucleopolyhedrovirus|Rep: ORF1629 - Chrysodeixis chalcites nucleopolyhedrovirus Length = 417 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP S PPPP PPP P PP P P Sbjct: 223 PPMSSIPPPPPPPPMPLTSIPPPPPPPPPP 252 >UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative lectin protein precursor - Emiliania huxleyi virus 86 Length = 1994 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 1689 PLPPSPPSPPPPSPPPPASPPLLPPAPPSPPPP 1721 Score = 38.3 bits (85), Expect = 0.28 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXX---PPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 493 PTPPPSPPPPPPSPPPSPFLPPPSLPPPPPPSPPPP 528 Score = 37.1 bits (82), Expect = 0.64 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP P P P P P PP Sbjct: 214 PSPPPSPAPPPPSPLPPPPLPPPPSPAPSPPPP 246 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P PP P P PP Sbjct: 491 PPPTPPPSPPPPPPSPPPSPFLPPPSLPPPPPP 523 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P P P P P PP Sbjct: 216 PPPSPAPPPPSPLPPPPLPPPPSPAPSPPPPPP 248 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP P P P PP P PP Sbjct: 695 PSPPPPSPPSPPPPSPPPPPSPPPPSLPPSPPP 727 Score = 35.1 bits (77), Expect = 2.6 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +1 Query: 745 PXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P L P P PSP P P PP P P P Sbjct: 1226 PPPPPPPSPPPSPPPPSPPPTPPPPLSPPPS-LPPPSSPPPSPNPPPAPPPPSPPPPLP 1283 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 1226 PPPPPPPSPPPSPPPPSPPPTPPPPLSPPPSLP 1258 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PP P PP P PP Sbjct: 1695 PSPPPPSPPPPASPPLLPPAPPSPPPPPDPAPP 1727 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PP P PPP P PP P P Sbjct: 699 PPSPPSPPPPSPPPPPSPPPPSLPPSPPPPYAP 731 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PP P PP P Sbjct: 849 PPPPLPPPPPPPNSPPPPYDPPPPPSPP 876 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P P P P P P PP Sbjct: 1232 PSPPPSPPPPSPPPTPPPPLSPPPSLPPPSSPP 1264 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S P PP PP P PP P PP Sbjct: 1683 PPPSEPPLPPSPPSPPPPSPPPPASPPLLPP 1713 Score = 33.9 bits (74), Expect = 5.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P P P P P P PP Sbjct: 205 PPPPPSPFPPSPPPSPAPPPPSPLPPPPLPPPP 237 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPP PPP P PP P Sbjct: 222 PPPPSPLPPPPLPPPPSPAPSPPPPPPP 249 Score = 33.9 bits (74), Expect = 5.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P PP P PP Sbjct: 495 PPPSPPPPPPSPPPSPFLPPPSLPPPPPPSPPP 527 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPX--PXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 1245 PTPPPPLSPPPSLPPPSSPPPSPNPPPAPPPPSPP 1279 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PPP P P P PP Sbjct: 507 PPSPFLPPPSLPPPPPPSPPPPSAPPIPLPP 537 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP PPP P PP PP Sbjct: 843 PCSPPS--PPPPLPPPPPPPNSPPPPYDPPPPP 873 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 92 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPP 124 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 106 PPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPP 138 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 204 PSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPP 236 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 32 PPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPP 64 Score = 37.9 bits (84), Expect = 0.36 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PPP PPP P PP P PP Sbjct: 27 PPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPP 60 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PP P PP P PP Sbjct: 88 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 120 Score = 37.5 bits (83), Expect = 0.48 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P PSP P P P P P P Sbjct: 84 PPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPP----PPSPPPSPPPSPSPPSPPPPSPPP 139 Query: 922 P 924 P Sbjct: 140 P 140 Score = 36.7 bits (81), Expect = 0.84 Identities = 20/70 (28%), Positives = 22/70 (31%), Gaps = 1/70 (1%) Frame = +1 Query: 718 GXLSSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSP-XXXPXPX 894 G ++ PP PP P P PP P P P P P Sbjct: 14 GAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPP 73 Query: 895 PPXXPXPXPP 924 PP P P PP Sbjct: 74 PPSPPPPSPP 83 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP PP Sbjct: 43 PLPPPS--PPPPSPPPSPPPPLPPPSPSPPSPP 73 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P P Sbjct: 52 PSPPPS--PPPPLPPPSPSPPSPPPPSPPPPSP 82 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP PP P PP Sbjct: 19 PPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPP 51 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P P P PP Sbjct: 24 PPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPP 56 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP PPP P PP P PP Sbjct: 46 PPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPP 78 Score = 35.9 bits (79), Expect = 1.5 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P P P P PP P P P Sbjct: 55 PPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSP 114 Query: 922 P 924 P Sbjct: 115 P 115 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PP P PP P PP Sbjct: 56 PSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPP 88 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP PP P PP Sbjct: 64 PPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPP 96 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 70 PSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPP 102 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P P Sbjct: 77 PPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSP 109 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 82 PPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSP 114 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 97 PSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSP 129 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 102 PSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPP 134 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 95 PPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 125 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P P PP P P P Sbjct: 198 PPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSP 230 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP S PPPP PPP P P P P Sbjct: 212 PPPSPPPPPPPPPPPPPSPPSPNPPPSASP 241 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP S PP P PP P PP P P Sbjct: 61 PLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPP 92 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P P PP P PP Sbjct: 212 PPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPP 244 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P PP + PPP PPP P PP P PP Sbjct: 197 PPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPP 231 Score = 34.3 bits (75), Expect = 4.5 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +1 Query: 745 PXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P PSP P P PP P P PP Sbjct: 27 PPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPP-PPSPPPP 85 >UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein - Emiliania huxleyi virus 86 Length = 403 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 136 PPPPPPPPPPPSSPPPSPPPPSSPPSPPPSSPP 168 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP PP P PP Sbjct: 140 PPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPP 172 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PP PP PP P PP Sbjct: 184 PSPPPSSPPSPPPSPPPSSPPSSPPSSPPSSPP 216 >UniRef50_Q0SAM5 Cluster: Putative uncharacterized protein; n=1; Rhodococcus sp. RHA1|Rep: Putative uncharacterized protein - Rhodococcus sp. (strain RHA1) Length = 362 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P PP P PP Sbjct: 311 PPPPAPAPPPPPPPAPEPQVNYPPPAAPAPVPP 343 >UniRef50_Q0C0P5 Cluster: OmpA family protein; n=1; Hyphomonas neptunium ATCC 15444|Rep: OmpA family protein - Hyphomonas neptunium (strain ATCC 15444) Length = 387 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 232 PAPPPPPPPPPPPPPPPPPPPPPPPPPPEETTP 264 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP PP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPEETTPP 265 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPEETTPP 265 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P P PP P P PP Sbjct: 231 PPAPPPPPPPPPPPPPPPPPPPPPP 255 Score = 35.5 bits (78), Expect = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXP 910 PP PPPP PPP P PP P Sbjct: 231 PPAPPPPPPPPPPPPPPPPPPPPPPP 256 Score = 35.1 bits (77), Expect = 2.6 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P + PPPP PPP P PP P P Sbjct: 231 PPAPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P P PPPP PPP P PP P Sbjct: 231 PPAPPPPPPPPPPPPPPPPPPPPPPPPP 258 >UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like protein precursor; n=5; Mycobacterium|Rep: U5 snRNP spliceosome subunit-like protein precursor - Mycobacterium sp. (strain JLS) Length = 137 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 83 PPPPPPPPPPPPGAPPPPPPPPPPPPPPVYVPP 115 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP PP Sbjct: 84 PPPPPPPPPPPGAPPPPPPPPPPPPPPVYVPPP 116 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P P P Sbjct: 90 PPPPPGAPPPPPPPPPPPPPPVYVPPPP 117 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 841 LXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 L PP P P P P PP P P PP Sbjct: 82 LPPPPPPPPPPPPGAPPPPPPPPPPPPP 109 >UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; Eukaryota|Rep: Putative pherophorin-dz1 protein - Oryza sativa subsp. japonica (Rice) Length = 342 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 82 PPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPP 114 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 110 PPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPP 142 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 111 PPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPP 143 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP PP Sbjct: 96 PPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPP 128 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP PP Sbjct: 95 PPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPP 127 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP + PPP PP P PP P P Sbjct: 118 PPPPATPPPPPRRAPPPPSPPIRPPPPPTPRP 149 >UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza sativa|Rep: Putative formin I2I isoform - Oryza sativa subsp. japonica (Rice) Length = 881 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPP 386 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 832 PXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P + PP P P P P P PP P P PP Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPPP PPP P PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPP 377 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP PP Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PP P PPP P PP P Sbjct: 362 PPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 >UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; Musa acuminata|Rep: Putative uncharacterized protein - Musa acuminata (Banana) Length = 390 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P PP P PP Sbjct: 173 PAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPP 205 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P PP P PP Sbjct: 181 PPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPP 213 Score = 37.1 bits (82), Expect = 0.64 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PP P PPP P PP P PP Sbjct: 169 PPPEPAPPTPEPPPPPGPEPPPPPGPEPPPP 199 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP P P P PP P P Sbjct: 189 PPPPGPEPPPPPAPEPPPPPAPEPPPPPPPKP 220 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P P PP P P PP Sbjct: 191 PPGPEPPPPPAPEPPPPPAPEPPPP 215 Score = 35.5 bits (78), Expect = 1.9 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P P P P P P P PP P P P Sbjct: 169 PPPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPA----PEPPPPPAPEPPPPPPPKPDPTP 224 Query: 922 P 924 P Sbjct: 225 P 225 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P+P P P PP P P PP Sbjct: 160 PPPEPEPAPPPPEPAP-PTPEPPPPPGPEPPPP 191 Score = 33.9 bits (74), Expect = 5.9 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P PP P P P P P PP P P P Sbjct: 164 PEPAPPPPEPAPPTPEPPPPPGPEPPPPPGPEP-PPPPAPEPPPPPAPEPPPPPPPKPDP 222 >UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=2; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 209 Score = 39.1 bits (87), Expect = 0.16 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPX--SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 74 PPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPP 108 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P S PPPP PPP PP P P Sbjct: 93 PPPAASPPPPPPSPPPPSPVKSSPPPPPAWSP 124 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP P PP P PP Sbjct: 75 PPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPP 109 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP PP P P P P Sbjct: 92 PPPPAASPPPPPPSPPPPSPVKSSPPPPPAWSP 124 >UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg protein - Ostreococcus tauri Length = 3738 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 8 PAPPSPPPPPSPPPPPSPAPPSPPPPPPSPPPP 40 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P P P PP Sbjct: 6 PPPAPPSPPPPPSPPPPPSPAPPSPPPPPPSPP 38 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P PP P PP Sbjct: 11 PSPPPPPSPPPPPSPAPPSPPPPPPSPPPPSPP 43 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 1808 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 1838 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP PP P P P PP Sbjct: 13 PPPPPSPPPPPSPAPPSPPPPPPSPPPPSPPPP 45 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPP PPP P PP P Sbjct: 1810 PSPPPPSPPPPSPPPPSPPPPSPPPPSP 1837 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP S PP P PPP PP P Sbjct: 19 PPPPPSPAPPSPPPPPPSPPPPSPPPPP 46 >UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 2146 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 935 PPPPVPSPPPPSPPPPSPPPLPPPPPPPSPPPP 967 Score = 38.7 bits (86), Expect = 0.21 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +1 Query: 724 LSSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPX 903 LS PP P PP P P PP P P P P P PP Sbjct: 874 LSCFPSPPPSPPPPSPPPPSPLPSPPPPSPPSPSPPPPS-PLPPSPSPPPPSPPSPSPPS 932 Query: 904 XPXPXP 921 P P P Sbjct: 933 PPPPPP 938 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 934 PPPPPVPSPPPPSPPPPSPPPLPPPPPPPSPPP 966 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PPP P PP P PP Sbjct: 878 PSPPPSPPPPSP-PPPSPLPSPPPPSPPSPSPP 909 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP P P P PP P PP Sbjct: 913 PLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPP 945 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P P Sbjct: 920 PPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSP 952 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PP P PP P PP Sbjct: 933 PPPPPPVPSPPPPSPPPPSPPPLPPPPPPPSPP 965 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP P P P PP P PP Sbjct: 925 PPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPP 957 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 923 PSPPSPSPPSPPPPPPVP--SPPPPSPPPPSPP 953 Score = 34.3 bits (75), Expect = 4.5 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPX---PPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 928 PSPP-SPPPPPPVPSPPPPSPPPPSPPPLPPPPPPP 962 >UniRef50_A3BQ84 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 2240 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 426 PPPPLPPPPPPPPPPPPPLPPNMPPPLPPPPEP 458 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 425 PPPPPLPPPPPPPPPPPP---PLPPNMPPPLPP 454 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPPP 455 >UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_43, whole genome shotgun sequence - Paramecium tetraurelia Length = 1401 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 832 PPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPP 864 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 847 PPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPP 879 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 831 PPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPP 863 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP P PP Sbjct: 825 PPPPPPPPPPGGKSAPPPPPPPPPP 849 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 846 PPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPP 878 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 888 PPPPPPGGPRPPGPPPPP--GGAPPLPPGPRPP 918 Score = 33.9 bits (74), Expect = 5.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP PPP P P PP Sbjct: 861 PPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPP 893 >UniRef50_Q7SC01 Cluster: Predicted protein; n=1; Neurospora crassa|Rep: Predicted protein - Neurospora crassa Length = 1395 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 331 PPPPPPPPPPPPPPPPPPIPPQLPPQVSAHIPP 363 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PPPP PPP P PP P P Sbjct: 324 PQLPIPTPPPPPPPPPPPPPPPPPPIPPQLPP 355 Score = 33.5 bits (73), Expect = 7.8 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P+P P P PP P P PP Sbjct: 324 PQLPIPTPPPPPPPPPPPPPPPPPP 348 >UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein), putative; n=1; Filobasidiella neoformans|Rep: Cytokinesis protein sepa (Fh1/2 protein), putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 1776 Score = 39.1 bits (87), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 1092 PPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPPP 1124 >UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Rep: Zgc:162320 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 412 Score = 38.7 bits (86), Expect = 0.21 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP + PPPP PPP P PP P Sbjct: 185 PGPPPAPGPPPPPPPPPPSGGGAPPAPP 212 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P P S PPPP PPP P PP P Sbjct: 174 PPAPASGPPPPPGPPPAPGPPPPPPPPP 201 >UniRef50_Q84647 Cluster: A333L protein; n=1; Paramecium bursaria Chlorella virus 1|Rep: A333L protein - Paramecium bursaria Chlorella virus 1 (PBCV-1) Length = 299 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 832 PXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P PP P PSP P P PP P P PP Sbjct: 214 PSVTSPPPPPKPSPPPSPKPSPPPSPKPSPP 244 >UniRef50_A5FXR4 Cluster: TonB family protein; n=1; Acidiphilium cryptum JF-5|Rep: TonB family protein - Acidiphilium cryptum (strain JF-5) Length = 249 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 78 PPPPPLPVPPPPVPPPPQPKPLPPPPAPSPMPP 110 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP PP Sbjct: 79 PPPPLPVPPPPVPPPPQPKPLPPPPAPSPMPPP 111 Score = 34.7 bits (76), Expect = 3.4 Identities = 22/83 (26%), Positives = 24/83 (28%), Gaps = 4/83 (4%) Frame = +1 Query: 685 LXXFXVPXARCGXLSSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPX 864 L + P A + P P PP P P L PP P Sbjct: 47 LPRYRTPLAPATTVHLVRLAPPLPLPPQPVQPPPPPLPVPPPPVPPPPQPKPLPPPPAPS 106 Query: 865 PSPXXXPXP----XPPXXPXPXP 921 P P P P PP P P P Sbjct: 107 PMPPPKPLPNVVHHPPPPPHPRP 129 >UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sativa|Rep: OSJNBb0018A10.6 protein - Oryza sativa (Rice) Length = 909 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 459 PPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPP 491 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PP P PPP PP P PP Sbjct: 470 PPPPPAPSPPAPPPPPPAPSPPAPPPPPPPCPP 502 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP P PP PPP P PP P P Sbjct: 445 PSPPAPSPPAPPPPPPVPSPSGPPPPPPPPAP 476 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP P P P PP P PP Sbjct: 447 PPAPSPPAPPPPPPVPSPSGPPPPPPPPAPSPP 479 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 468 PPPPPPPAPSPPAPPP-PPPAPSPPAPPPPPPP 499 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P PSP P P PP P P P Sbjct: 457 PPPPVPSPSGPPPPPPPPAPSPPAP 481 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PP P PPP P P PP Sbjct: 482 PPPPPAPSPPAPPPPPPPCPPAPPKTRSRHAPP 514 >UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vulgaris|Rep: Chitinase - Beta vulgaris subsp. vulgaris Length = 439 Score = 38.7 bits (86), Expect = 0.21 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P P P PSP P P PP P P P Sbjct: 112 PTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPSPPSPEPPTPPEPTP 171 Query: 922 P 924 P Sbjct: 172 P 172 Score = 37.1 bits (82), Expect = 0.64 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 745 PXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PP P P P P P PP P P PP Sbjct: 48 PSRPTPPRPPTPRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPP 107 Score = 37.1 bits (82), Expect = 0.64 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 745 PXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PP P P P P P PP P P PP Sbjct: 66 PPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPP 125 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP---PXPXXXXXPPXXPXXXPP 925 P PP + PPPP PP P P PP P PP Sbjct: 98 PPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPP 133 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 109 PRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPP 143 Score = 36.3 bits (80), Expect = 1.1 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +1 Query: 745 PXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P PP P P P P P PP P P PP Sbjct: 61 PPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPR---PPTPRPPPPPTPRPPPPRPPTPRPP 117 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 827 PXPPXSXXPPP----PXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP P PPP P PP P PP Sbjct: 99 PPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPPPP 135 >UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n=5; root|Rep: Chromosome 13 contig 1, DNA sequence - Ostreococcus tauri Length = 1990 Score = 38.7 bits (86), Expect = 0.21 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P P P P P PP P P P Sbjct: 781 PPPSPPPPNPPPLPSPPPPSPPPPSPTPPLPP----PPSPFPPPSPSPSPPPPSPPPPSP 836 Query: 922 P 924 P Sbjct: 837 P 837 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP P P P PP P PP Sbjct: 826 PPPPSPPPPSPPPPSPPPPSPFPPPAPPPPSPP 858 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP PPP PP PP Sbjct: 818 PPPSPSPSPPPPSPPPPSPPPPSPPPPSPFPPP 850 Score = 33.9 bits (74), Expect = 5.9 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPP---XXPX 912 PP P PP P P PP P P P P P PP P Sbjct: 790 PPPLPSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPPPSPPPPSPFPP 849 Query: 913 PXPP 924 P PP Sbjct: 850 PAPP 853 >UniRef50_Q9VC76 Cluster: CG13615-PA; n=2; Sophophora|Rep: CG13615-PA - Drosophila melanogaster (Fruit fly) Length = 290 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 73 PPPPPPPPPPPPPPPPPPPSPPGVPANPVSLPP 105 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PPPP PPP P PP P P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVP 97 >UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 370 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P P PP P P PP Sbjct: 300 PYPAPTPYPPPPPPYPEQVPPPPPPPPPPPPPP 332 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + P PP PPP P PP P PP Sbjct: 298 PPPYPAPTPYPPPPPPYPEQVPPPPPPPPPPPP 330 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P P PPP P PP P PP Sbjct: 296 PPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPPP 328 Score = 33.5 bits (73), Expect = 7.8 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P PP P P P P PP P P P Sbjct: 276 PPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPPPPPPPPYP 335 >UniRef50_A1CD74 Cluster: DUF1720 domain protein; n=17; Pezizomycotina|Rep: DUF1720 domain protein - Aspergillus clavatus Length = 1485 Score = 38.7 bits (86), Expect = 0.21 Identities = 20/70 (28%), Positives = 21/70 (30%) Frame = +1 Query: 700 VPXARCGXLSSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXX 879 VP A + PP P PP P P PP P P P Sbjct: 1369 VPEASASLSAPAAPPPPPPPPPPPASAPMVVPSYDPSTAPPPPPPAPPIAPPAPPPGPPP 1428 Query: 880 XPXPXPPXXP 909 P P PP P Sbjct: 1429 PPGPPPPPAP 1438 >UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=2; Mus musculus|Rep: FH1/FH2 domain-containing protein 1 - Mus musculus (Mouse) Length = 1197 Score = 38.7 bits (86), Expect = 0.21 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P S PPPP PPP P PP P PP Sbjct: 581 PSLSGGPPPPPPPPPPITGSCPPPPPPPLPP 611 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PPPP PPP P PP P P Sbjct: 610 PPPATGSCPPPPPPPPPPIIGSCPPPPPLAAP 641 Score = 35.1 bits (77), Expect = 2.6 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPX--SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP P P P PP P PP Sbjct: 593 PPPPITGSCPPPPPPPLPPPATGSCPPPPPPPPPP 627 >UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain binding protein; n=2; Mus musculus|Rep: PREDICTED: similar to SH3 domain binding protein - Mus musculus Length = 455 Score = 38.3 bits (85), Expect = 0.28 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 2 PVPPPPPPPPPPPPPP-PPPLGAPPPPPLGAPP 33 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP PP Sbjct: 5 PPPPPPPPPPPPPPPPLGAPPPPPLGAPPPP 35 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P PP P PP Sbjct: 9 PPPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPP 41 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP PP Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPPLGAPPPPP 36 >UniRef50_UPI0000F30E84 Cluster: UPI0000F30E84 related cluster; n=1; Bos taurus|Rep: UPI0000F30E84 UniRef100 entry - Bos Taurus Length = 921 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 778 PPPPPLALPPPPPPPPPPPPPPLPPSHPNPEVP 810 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P + PP P P P P P PP P P PP Sbjct: 767 PHKALVHLPPPPPPPPLALPPPPPPPPPPPPPP 799 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP PPP P P PP Sbjct: 779 PPPPLALPPPPPPPPPPPPPPLPPSHPNPEVPP 811 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P P Sbjct: 786 PPPPPPPPPPPPPPLPPSHPNPEVPPEQKQP 816 >UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa0079B05.10; n=4; Oryza sativa|Rep: Putative uncharacterized protein OSJNBa0079B05.10 - Oryza sativa (Rice) Length = 1269 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P S PPPP PPP P PP P PP Sbjct: 613 PNRSVPPPPPPPPPLPNHSVLPPPPPPPPPP 643 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXP-PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P P + PPPP PPP P P P PP Sbjct: 535 PSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPP 568 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP---XXXXXPPXXPXXXPP 925 P P + PPPP PPP P PP P PP Sbjct: 537 PSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPP 572 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P P P PP Sbjct: 583 SQPPPPPPPPPLPNCLVPSPPPPPPPPP 610 >UniRef50_Q6YYS1 Cluster: Putative uncharacterized protein B1047A05.11; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein B1047A05.11 - Oryza sativa subsp. japonica (Rice) Length = 107 Score = 38.3 bits (85), Expect = 0.28 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP S PPPP PP P PP P P Sbjct: 35 PSPPSSTLPPPPPAPPPPPPSLPPPPPPPPSP 66 >UniRef50_Q9FPQ6 Cluster: Vegetative cell wall protein gp1 precursor; n=14; root|Rep: Vegetative cell wall protein gp1 precursor - Chlamydomonas reinhardtii Length = 555 Score = 38.3 bits (85), Expect = 0.28 Identities = 23/87 (26%), Positives = 27/87 (31%), Gaps = 1/87 (1%) Frame = +1 Query: 667 PTPIXFLXXFXVPXARCGXLSSXXXPPXXPXP-PXXXXXXXXXXXXXXXXXXXXPXPXXL 843 P+P L P + + PP P P P P P Sbjct: 140 PSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVP 199 Query: 844 XXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P+P P P PP P P PP Sbjct: 200 PSPAPPSPAPPVPPSPAPPSPPSPAPP 226 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP S PPPP PP P PP P P Sbjct: 264 PPPPPSPPPPPPPRPPFPANTPMPPSPPSPPP 295 Score = 36.7 bits (81), Expect = 0.84 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 745 PXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P PP P PSP P P P P P P Sbjct: 305 PPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSPSPSPSPSP 363 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P+P P P PP P P PP Sbjct: 202 PAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAPP 234 Score = 34.3 bits (75), Expect = 4.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PP P P P PP Sbjct: 291 PSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPP 323 Score = 33.9 bits (74), Expect = 5.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P PSP P P PP P PP Sbjct: 116 PAPPSPPSPAPPSPSPPAPPSPSPPSPAPPLPP 148 >UniRef50_UPI0000DA3E0C Cluster: PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor; n=2; Rattus norvegicus|Rep: PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor - Rattus norvegicus Length = 542 Score = 37.9 bits (84), Expect = 0.36 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP PPP P PP P PP Sbjct: 414 PVPPPTPPPPPPPPPPPP----PPPPPPVKAPP 442 Score = 37.1 bits (82), Expect = 0.64 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PPPP PPP P PP P PP Sbjct: 405 PEKKEKPPPPVPPPTPPPPPPPPPPPPPPPP 435 Score = 36.7 bits (81), Expect = 0.84 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P PP P P PP Sbjct: 413 PPVPPPTPPPPPPPPPPPPPPPPPP 437 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP PPP P PP PP Sbjct: 323 PVPPPAPPPPPPPPPPPP---RPPPPPAIVRPP 352 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P L P P P P P P PP P P PP Sbjct: 309 PAPK-LKQPGHPPPRPVPPPAPPPPPPPPPPPP 340 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PP P PPP P PP P P Sbjct: 411 PPPPVPPPTPPPPPPPPPPPPPPPPPPVKAP 441 >UniRef50_UPI0000DC00CB Cluster: SH3 domain binding protein CR16; n=1; Rattus norvegicus|Rep: SH3 domain binding protein CR16 - Rattus norvegicus Length = 456 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP + PPPP PPP P PP P P Sbjct: 196 PPPTTPPPPPPPPPPPPPPPLPPASPIKAP 225 Score = 35.5 bits (78), Expect = 1.9 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPX-PXPSPXXXPXPXPPXXPXPX 918 PP P PP P P P P P P P P PP P P Sbjct: 202 PPPPPPPPPPPPPPLPPASPIKAPSVSPPVPPTKGNPSAVPAPIPCVPPLPPPPPTPPPL 261 Query: 919 PP 924 PP Sbjct: 262 PP 263 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P P P PP Sbjct: 198 PTTPPPPPPPPPPPPPPPLPPASPIKAPSVSPP 230 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P PP Sbjct: 317 PPPPPPPPPPPPPPLPTYASCSPRAAVAPPP 347 >UniRef50_UPI0000F30DFE Cluster: UPI0000F30DFE related cluster; n=1; Bos taurus|Rep: UPI0000F30DFE UniRef100 entry - Bos Taurus Length = 591 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PPPP PPP P PP P P Sbjct: 334 PPPSPQPPPPSPPPPPSSPSSPPPSPPQPLP 364 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP PP P PP Sbjct: 333 PPPPSPQPPPPSPPPPPSSPSSPPPSPPQPLPP 365 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP PP P PP P PP Sbjct: 345 PPPPPSSPSSPPPSPPQPLPPSPPPSPPPSLPP 377 >UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 3 SCAF14978, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1449 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 1092 PTPPPPPPPPPPPPPPAPVTGPTPPAPP 1119 Score = 36.7 bits (81), Expect = 0.84 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P PP P P PP Sbjct: 1081 PPPPPPAPVTGPTPPPPPPPPPPPP 1105 Score = 35.1 bits (77), Expect = 2.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PSP P P PP P P P Sbjct: 944 PPAPTPSPPPPPPPPPPPPPPPPP 967 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 841 LXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 L P P P+P P P PP P P PP Sbjct: 939 LEESPPPAPTPSPPPPPPPPPPPPPPPP 966 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P + PPPP PPP P PP P Sbjct: 943 PPPAPTPSPPPPPPPPPPPPPPPPPQQQFQLP 974 Score = 29.9 bits (64), Expect(2) = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP S PPP PPP P Sbjct: 1246 PPPPASELFPPPPPPPPP 1263 Score = 23.8 bits (49), Expect(2) = 2.8 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 854 PPPXPPPXPXXXXXP 898 PPP PPP P P Sbjct: 1287 PPPPPPPVPLVSSSP 1301 >UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2; Hyphomonadaceae|Rep: OmpA/MotB domain protein precursor - Maricaulis maris (strain MCS10) Length = 359 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 243 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 218 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 Score = 37.1 bits (82), Expect = 0.64 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP PPPP PPP P PP P P Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPP PPP P PP P PP Sbjct: 212 SFAAPPPPPPPPPPPPPPPPPPPPPPPP 239 >UniRef50_Q01B16 Cluster: Chromosome 04 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 04 contig 1, DNA sequence - Ostreococcus tauri Length = 1138 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P PSP P P PP P P PP Sbjct: 620 PPPPSPSPPPPPPPSPPPPPPPSPP 644 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P P PP P P PP Sbjct: 622 PPSPSPPPPPPPSPPPPPPPSPPPP 646 >UniRef50_Q00S27 Cluster: Chromosome 19 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 19 contig 1, DNA sequence - Ostreococcus tauri Length = 1757 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P PSP P P PP P P PP Sbjct: 305 PPSPPPSPPPSPPPSPPPSPPPSPP 329 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P PSP P P PP P P PP Sbjct: 309 PPSPPPSPPPSPPPSPPPSPPPSPP 333 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P PSP P P PP P P PP Sbjct: 313 PPSPPPSPPPSPPPSPPPSPPPSPP 337 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PPP PPP P P P PP Sbjct: 306 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPP 339 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PPP PPP P P P PP Sbjct: 310 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPP 343 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 303 PAPPSPPPSPPPSPPPSP-PPSPPPSPPPSPPP 334 Score = 33.9 bits (74), Expect = 5.9 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P PSP P P PP P P PP Sbjct: 302 PPAP-PSPPPSPPPSPPPSPPPSPP 325 >UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamydomonas reinhardtii|Rep: Cell wall glycoprotein GP2 - Chlamydomonas reinhardtii Length = 1226 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P L PP P P P P PP P P PP Sbjct: 967 PPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPP 999 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP---XPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 954 PPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPP 989 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP P P P PP P PP Sbjct: 952 PSPPPPTPPSPPPPSPPPPVLSPPPSPPPPSPP 984 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 976 PSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSP 1008 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 981 PSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSP 1013 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP P P P PP P PP Sbjct: 998 PPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPP 1030 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 974 PPPSPPPPSPPPPAPPPPSPPPPVPPPPSPP 1004 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 979 PPPSPPPPAPPPPSPPPPVPPPPSPPPPSPP 1009 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP-XPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 996 PVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPP 1029 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP--XXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 991 PSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPP 1025 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +2 Query: 827 PXPPXSXXPPP----PXPPPXPXXXXXPPXXPXXXP 922 P PP + PPP P PPP P PP P P Sbjct: 777 PPPPPAPSPPPKPPTPSPPPLPPQPNPPPAPPSPNP 812 Score = 33.5 bits (73), Expect = 7.8 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP + PPP PPP P PP Sbjct: 1011 PSPPPAAASPPPSPPPPPPPSPPPP 1035 >UniRef50_Q5CS67 Cluster: Signal peptide containing large protein with proline stretches; n=2; Cryptosporidium|Rep: Signal peptide containing large protein with proline stretches - Cryptosporidium parvum Iowa II Length = 1884 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 1546 PPPPPPPPPPPPPPPPPPSPPPSPPPSP 1573 Score = 37.5 bits (83), Expect = 0.48 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P S PPPP PPP P PP P PP Sbjct: 1538 PSSGSSAPPPPPPPPPPPPPPPPPPPSPPPSPP 1570 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P P Sbjct: 1421 PPPPHSPPPPPPPPPPSSPPSPPPSPPPYTP 1451 Score = 36.7 bits (81), Expect = 0.84 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 5/38 (13%) Frame = +2 Query: 827 PXPPXSXX-----PPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 1534 PHPPPSSGSSAPPPPPPPPPPPPPPPPPPPSPPPSPPP 1571 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP PP P P Sbjct: 1420 PPPPPHSPPPPPPPPPPSSPPSPPPSPPPYTP 1451 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 1545 PPPPP---PPPPPPPPPPPPPPSPPPSPPPSP 1573 Score = 34.3 bits (75), Expect = 4.5 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 827 PXPPXSXX----PPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P P Sbjct: 1169 PHPPPSSGSFTPPPPPPPPPPPPPPPPPPPPPSYTSP 1205 >UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1561 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP S PPPP PPP P P P P Sbjct: 1038 PPPPISGAPPPPPPPPPPMKGGAGPPPPPPPP 1069 >UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyostelium discoideum AX4|Rep: Slob family protein kinase - Dictyostelium discoideum AX4 Length = 574 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP PPP PP P PP Sbjct: 504 PPPSKSSGPPPPPPPPPKSSGPPPPPPPKSSPP 536 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 503 PPPPSKSSGPPPPPPPPPKSSGPPPPPPPKSSP 535 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP S PPPP PPP P PP P P Sbjct: 492 PPISSPPPPP-PPPPPSKSSGPPPPPPPPP 520 >UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: Formin, putative - Leishmania major Length = 1300 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 664 PPPPPPPPPPPPPPPPPPRMGNGPPPPP 691 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P P P Sbjct: 663 PPPPPPPPPPPPPPPPPPPRMGNGPPPP 690 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PPPP PPP P PP PP Sbjct: 660 PKQPPPPPPPPPPPPPPPPPPPRMGNGPPP 689 >UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 620 Score = 37.9 bits (84), Expect = 0.36 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXP-PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P P PPPP PPP P PP P PP Sbjct: 423 PCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPP 456 Score = 37.1 bits (82), Expect = 0.64 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +1 Query: 742 PPXXPXP-PXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPX 918 PP P P P P P P P P+P P P PP P P Sbjct: 369 PPPPPCPGPYECLSPYPVPYPYPSPVPYPPPPAPYPPPSAPYPAPYTPPSPPPPPCPVPC 428 Query: 919 PP 924 PP Sbjct: 429 PP 430 Score = 37.1 bits (82), Expect = 0.64 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P + PP P P P P P PP P P P Sbjct: 437 PPPCPVPCPPPPPPPPPSPPPPPPPPCPIPCP 468 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP P P P PP P PP Sbjct: 430 PPPPPPPPPPCPVPCPPPPPPPPPSPPPPPP 460 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P P PP P P PP Sbjct: 422 PPCPVPCPPPPPPPPPPPCPVPCPP 446 Score = 35.5 bits (78), Expect = 1.9 Identities = 23/88 (26%), Positives = 25/88 (28%), Gaps = 2/88 (2%) Frame = +1 Query: 667 PTPIXFLXXFXVPXARCGXLSSXXXPPXXPXP--PXXXXXXXXXXXXXXXXXXXXPXPXX 840 P P L + VP + P P P P P P Sbjct: 375 PGPYECLSPYPVPYPYPSPVPYPPPPAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPP 434 Query: 841 LXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P P P P P PP Sbjct: 435 PPPPPCPVPCPPPPPPPPPSPPPPPPPP 462 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PPPP PPP P PP P P Sbjct: 422 PPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPP 453 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP P PP PPP P PP P P Sbjct: 435 PPPPPCPVPCPPPPPPPPPSPPPPPPPPCPIP 466 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P P P P Sbjct: 447 PPPPPPPSPPPPPPPPCPIPCPEPYPVPVPIP 478 Score = 33.9 bits (74), Expect = 5.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP S PPPP P P P P P P Sbjct: 449 PPPPPSPPPPPPPPCPIPCPEPYPVPVPIPEP 480 >UniRef50_A2DXB4 Cluster: Formin Homology 2 Domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1322 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP PP P PP P PP Sbjct: 702 PTPPSSPIQPPPPSPPPPAPISLPPGVPPPPPP 734 >UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa group|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 309 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP PP PP Sbjct: 252 PPPPSSSLPPPPPPPPPSSTRPPPPPPAQTTPP 284 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP PPP PP PP Sbjct: 253 PPPSSSLPPPPPPPPPSSTRPPPPPPAQTTPPP 285 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXP 910 PP S P PP PPP P PP P Sbjct: 240 PPPSHTPAPPPPPPPPSSSLPPPPPP 265 >UniRef50_Q9Y6V0 Cluster: Protein piccolo; n=17; Amniota|Rep: Protein piccolo - Homo sapiens (Human) Length = 5183 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 2337 PPPPPPPPPPPPPPPPPPPPPLPPPTSP 2364 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P PP P PP Sbjct: 2333 SAQPPPPPPPPPPPPPPPPPPPPPPLPP 2360 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPPP PPP P PP Sbjct: 2336 PPPPPPPPPPPPPPPPPPPPPPLPP 2360 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP P PP Sbjct: 2337 PPPPPPPPPPPPPPPPPPPPPLPPP 2361 >UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|Rep: Formin-like protein 1 - Homo sapiens (Human) Length = 1100 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P L PP P P P P PP P P PP Sbjct: 579 PLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPP 611 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P P P PP Sbjct: 578 PPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPP 610 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 576 PAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPP 608 >UniRef50_P13983 Cluster: Extensin precursor; n=1; Nicotiana tabacum|Rep: Extensin precursor - Nicotiana tabacum (Common tobacco) Length = 620 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP PP P PP P PP Sbjct: 370 PPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPP 402 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP PP Sbjct: 363 PPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPP 395 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PP P PP P PP Sbjct: 404 PAPPTYSPPPPTYSPPPPTYAQPPPLPPTYSPP 436 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PP P PP P PP Sbjct: 443 PPPPTYSPPPPTYSPPPPAYAQPPPPPPTYSPP 475 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXP--PPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P PP P PP Sbjct: 457 PPPPAYAQPPPPPPTYSPPPPAYSPPPPSPIYSPP 491 >UniRef50_Q4P6X2 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 1859 Score = 29.9 bits (64), Expect(2) = 0.44 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P PP PPPP PPP Sbjct: 988 PPPPPPPPPPPPPPPP 1003 Score = 29.9 bits (64), Expect(2) = 1.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXP 880 PP PPPP PPP P Sbjct: 988 PPPPPPPPPPPPPPPP 1003 Score = 26.6 bits (56), Expect(2) = 0.44 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXP 898 PPPP PPP P P Sbjct: 1029 PPPPPPPPPPAPGMMP 1044 Score = 25.0 bits (52), Expect(2) = 1.3 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 854 PPPXPPPXPXXXXXPPXXP 910 PPP PPP P P P Sbjct: 1026 PPPPPPPPPPPPPAPGMMP 1044 >UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF13974, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 692 Score = 37.5 bits (83), Expect = 0.48 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 113 PLPPP---PPPPPPPPLPSFTLSPPPPPPPPPP 142 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP P PP P PP Sbjct: 125 PLPSFTLSPPPPPPPPPP-----PPLPPSPRPP 152 >UniRef50_Q5CHL3 Cluster: Hydroxyproline-rich glycoprotein dz-hrgp; n=8; Cryptosporidium|Rep: Hydroxyproline-rich glycoprotein dz-hrgp - Cryptosporidium hominis Length = 328 Score = 37.5 bits (83), Expect = 0.48 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 227 PPPPP---PPPPPPPPSPPPQSPPPQSPPSLPP 256 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PPPP PPP P PP P P Sbjct: 221 PSNDDFPPPPPPPPPPPPPSPPPQSPPPQSP 251 >UniRef50_Q54U84 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 674 Score = 37.5 bits (83), Expect = 0.48 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PP PP P PP Sbjct: 315 PPPPSSPPPPPPPSPPRVPFLPPPPPPPPLSPP 347 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PP P PP P Sbjct: 313 PPPPPPSSPPPPPPPSPPRVPFLPPPPP 340 Score = 33.5 bits (73), Expect = 7.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 832 PXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P L PP P SP P P PP P PP Sbjct: 308 PHDLPPPPPPPSSPPPPPPPSPPRVPFLPPP 338 >UniRef50_Q504V9 Cluster: ZNF341 protein; n=10; Euteleostomi|Rep: ZNF341 protein - Homo sapiens (Human) Length = 795 Score = 37.5 bits (83), Expect = 0.48 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 124 PPPPPLPPPPPPQPPPPPPQSLGPPGRP 151 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 832 PXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P L PP P P P P P PP P P P Sbjct: 113 PSYLTQPPPPPPPPPPLPPPPPPQPPPPPP 142 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP PPPP PPP P PP P Sbjct: 119 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPP 148 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PPP PPP P PP P PP Sbjct: 113 PSYLTQPPPPPPPPPPLPPPPPPQPPPPPP 142 >UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1; n=2; Sordariomycetes|Rep: Putative uncharacterized protein NCU01431.1 - Neurospora crassa Length = 1817 Score = 37.5 bits (83), Expect = 0.48 Identities = 24/86 (27%), Positives = 24/86 (27%) Frame = +1 Query: 667 PTPIXFLXXFXVPXARCGXLSSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLX 846 P P FL P G PP P PP P P Sbjct: 1041 PPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPP--- 1097 Query: 847 XPPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P PP P P P Sbjct: 1098 -PPPPMPGMAGMPPPPPPPPPMPGMP 1122 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 1090 PPPP----PPPPPPPPMPGMAGMPPPPPPPPP 1117 >UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 115 Score = 37.5 bits (83), Expect = 0.48 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP--XXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 19 PPPPPQPPPPPPQPPPPPPSLLPQPPPPPPLLSPP 53 >UniRef50_Q9BYN7 Cluster: Zinc finger protein 341; n=86; Eumetazoa|Rep: Zinc finger protein 341 - Homo sapiens (Human) Length = 854 Score = 37.5 bits (83), Expect = 0.48 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 183 PPPPPLPPPPPPQPPPPPPQSLGPPGRP 210 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 832 PXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P L PP P P P P P PP P P P Sbjct: 172 PSYLTQPPPPPPPPPPLPPPPPPQPPPPPP 201 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP PPPP PPP P PP P Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPP 207 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PPP PPP P PP P PP Sbjct: 172 PSYLTQPPPPPPPPPPLPPPPPPQPPPPPP 201 >UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - Homo sapiens (Human) Length = 1419 Score = 37.5 bits (83), Expect = 0.48 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP PPP P P P PP Sbjct: 912 PLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPP 944 Score = 33.9 bits (74), Expect = 5.9 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 827 PXPPXSXXPP----PPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP PP PPP P P P PP Sbjct: 893 PMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPP 929 Score = 33.5 bits (73), Expect = 7.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 9/42 (21%) Frame = +2 Query: 827 PXPPXSXXPPPPXP---------PPXPXXXXXPPXXPXXXPP 925 P PP S PPPP P PP P PP P PP Sbjct: 869 PPPPASIPPPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPP 910 >UniRef50_Q9UPT8 Cluster: Zinc finger CCCH domain-containing protein C19orf7; n=20; Theria|Rep: Zinc finger CCCH domain-containing protein C19orf7 - Homo sapiens (Human) Length = 1303 Score = 37.5 bits (83), Expect = 0.48 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP S PPPP PPP P PP P P Sbjct: 8 PPPPPSESPPPPSPPP-PSTPSPPPCSPDARP 38 >UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1102 Score = 37.1 bits (82), Expect = 0.64 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P + PPPP PPP P PP P P Sbjct: 571 PPSPAAAPPPPPPPPPLPGAEAPPPPPPPPPP 602 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP P P P PP Sbjct: 585 PPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPP 617 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP PP P PP Sbjct: 586 PLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPP 618 Score = 34.7 bits (76), Expect = 3.4 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXX---PPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P P Sbjct: 598 PPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGP 633 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PPP P P P PP Sbjct: 571 PPSPAAAPPPPPPPPPLPGAEAPPPPPPPPP 601 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P + PPPP PPP PP P PP Sbjct: 572 PSPAAAPPPPPPPPPLPGAEAPPPPPPPPPP 602 >UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n=2; Rattus norvegicus|Rep: UPI0000DC1448 UniRef100 entry - Rattus norvegicus Length = 319 Score = 37.1 bits (82), Expect = 0.64 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP PP P PP P PP Sbjct: 111 PPSPPSPPPPPPPLPPSPSPPSPPPPSPPPLPP 143 Score = 34.3 bits (75), Expect = 4.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP S PPPP PPP P Sbjct: 179 PPPPLSPSPPPPPPPPPP 196 >UniRef50_Q4SVG8 Cluster: Chromosome undetermined SCAF13758, whole genome shotgun sequence; n=4; Tetraodontidae|Rep: Chromosome undetermined SCAF13758, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 928 Score = 37.1 bits (82), Expect = 0.64 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P P PP P PP Sbjct: 352 PLPQLPLPPPPPPPSPPSSPLPPPPLSPPSPPP 384 >UniRef50_A5IZX7 Cluster: Odv-e66; n=1; Spodoptera litura granulovirus|Rep: Odv-e66 - Spodoptera litura granulovirus Length = 715 Score = 37.1 bits (82), Expect = 0.64 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXP-PXPXPSPXXXPXPXPPXXPXP 915 PP P PP P P L P P P P+P P P PP P P Sbjct: 33 PPPCPEPPPVPSPEPTPVPSPEPTPVPSPEPTPLPSPEPSPEPTPMPSPEPTPPSSPDP 91 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXPP 924 P P + P P P PSP P P P P P PP Sbjct: 53 PEPTPVPSPEPTPLPSPEPSPEPTPMPSPEPTPP 86 >UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: Enabled homolog - Rattus norvegicus (Rat) Length = 526 Score = 37.1 bits (82), Expect = 0.64 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP PPP P PP P P Sbjct: 294 PPPLPSAGPPPPPPPPPPLPNQVPPPPPPPPAP 326 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PPPP PPP P PP P P Sbjct: 296 PLPSAGPPPPPPPPPPLPNQVPPPPPPPPAPP 327 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP PP P PP Sbjct: 295 PPLPSAGPPPPPPPPPPLPNQVPPPPPPPPAPP 327 Score = 33.5 bits (73), Expect = 7.8 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 3/64 (4%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPX---PXPPXXPX 912 PP P PP P P PP P P P P P PP P Sbjct: 266 PPAPPPPPPLPSGPAYASALPPPPGPPPPPPLPSAGPPPPPPPPPPLPNQVPPPPPPPPA 325 Query: 913 PXPP 924 P P Sbjct: 326 PPLP 329 >UniRef50_Q0JD12 Cluster: Os04g0438100 protein; n=2; Oryza sativa|Rep: Os04g0438100 protein - Oryza sativa subsp. japonica (Rice) Length = 200 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG + GG G Sbjct: 131 GGGGGGGGGGGGGGGGGGGGGGGGGGGQCGGGG 163 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 142 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 143 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 148 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 149 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 118 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 150 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 119 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 151 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 120 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 152 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 121 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 153 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 122 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 154 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 155 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 156 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 125 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 157 >UniRef50_Q013S1 Cluster: Chromosome 08 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 08 contig 1, DNA sequence - Ostreococcus tauri Length = 736 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 685 PSPPPPSPPPPPSPPPPP----SPPPPPSPPPP 713 >UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 196 Score = 37.1 bits (82), Expect = 0.64 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P P P P P PP Sbjct: 19 PPPPSPSPPPPPSPSPSPPPPPSPSPPPSPPPP 51 Score = 35.9 bits (79), Expect = 1.5 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P P S PPPP PPP P PP P PP Sbjct: 11 PPTPLSPPPPPPSPSPPPPPSPSPSPPPPPSPSPP 45 Score = 34.3 bits (75), Expect = 4.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P PSP P P P P P P Sbjct: 9 PPPPTPLSPPPPPPSPSPPPPPSPSPSPPPPP 40 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP P P P P P PP Sbjct: 18 PPPPPSPSPPPP-PSPSPSPPPPPSPSPPPSPP 49 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PP PPP P PP PP Sbjct: 26 PPPPPSPSPSPP-PPPSPSPPPSPPPPSSPPPP 57 >UniRef50_Q86BM9 Cluster: CG33003-PA; n=1; Drosophila melanogaster|Rep: CG33003-PA - Drosophila melanogaster (Fruit fly) Length = 579 Score = 37.1 bits (82), Expect = 0.64 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP PPPP PPP P PP P P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP P PP Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPP 487 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP PP P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPP 490 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PP P PP P Sbjct: 465 PPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 >UniRef50_Q581C6 Cluster: Flagellum-adhesion glycoprotein, putative; n=2; Trypanosoma brucei|Rep: Flagellum-adhesion glycoprotein, putative - Trypanosoma brucei Length = 590 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP PPP P PP P PP Sbjct: 363 PSPSPSVQPPPP-PPPPPPPPPPPPITPNPDPP 394 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P PSP P P P P P PP Sbjct: 352 PPSPSPSPSASPSPSPSVQPPPPPP 376 >UniRef50_Q20327 Cluster: Ground-like (Grd related) protein 4; n=2; Caenorhabditis|Rep: Ground-like (Grd related) protein 4 - Caenorhabditis elegans Length = 210 Score = 37.1 bits (82), Expect = 0.64 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP PPPP PPP P PP P P Sbjct: 57 PPPPMCPPPPPPPPPPMCPPPPPPMPSYSP 86 >UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 536 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 434 PPPP----PPPPPPPPSPPAPPPPPPPPVITPP 462 Score = 35.5 bits (78), Expect = 1.9 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P P + PPPP PPP P PP P Sbjct: 427 PAPAAAAPPPPPPPPPPPPSPPAPPPPP 454 Score = 33.5 bits (73), Expect = 7.8 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P + PPPP PPP P PP P PP Sbjct: 429 PAAAAPPPPPPPPPP--PPSPPAPPPPPPP 456 >UniRef50_Q9UMN6 Cluster: WW domain-binding protein 7; n=16; Eukaryota|Rep: WW domain-binding protein 7 - Homo sapiens (Human) Length = 2715 Score = 37.1 bits (82), Expect = 0.64 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PP P PP PP Sbjct: 416 PLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPPP 448 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPX--PXXXXXPPXXPXXXPP 925 P P + PPPP PPP P PP P PP Sbjct: 405 PLTPPAPSPPPPLPPPSTSPPPPLCPPPPPPVSPP 439 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 37.1 bits (82), Expect = 0.64 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXX---PPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP PPP P PP P PP Sbjct: 1042 PPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPP 1077 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP P PP Sbjct: 1036 PPPPPPPPPPGAGAAPPPPPPPPPP 1060 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P P PPPP PPP P PP P Sbjct: 1060 PPPGGLGGPPPPPPPPPPGGFGGPPPPP 1087 >UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleostomi|Rep: Protein enabled homolog - Mus musculus (Mouse) Length = 802 Score = 37.1 bits (82), Expect = 0.64 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP PPP P PP P P Sbjct: 570 PPPLPSTGPPPPPPPPPPLPNQAPPPPPPPPAP 602 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PPPP PPP P PP P P Sbjct: 572 PLPSTGPPPPPPPPPPLPNQAPPPPPPPPAPP 603 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP PPP P PP P PP Sbjct: 434 PPTSGPAAPPPPPPPPPPPPPPPLPPPPLPP 464 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP PP P PP Sbjct: 571 PPLPSTGPPPPPPPPPPLPNQAPPPPPPPPAPP 603 Score = 33.5 bits (73), Expect = 7.8 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 3/64 (4%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPX---PXPPXXPX 912 PP P PP P P PP P P P P P PP P Sbjct: 542 PPAPPPPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPNQAPPPPPPPPA 601 Query: 913 PXPP 924 P P Sbjct: 602 PPLP 605 >UniRef50_A7P6N9 Cluster: Chromosome chr9 scaffold_7, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr9 scaffold_7, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 556 Score = 29.9 bits (64), Expect(2) = 0.79 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P PP PPPP PPP Sbjct: 217 PSPPLPPSPPPPPPPP 232 Score = 25.8 bits (54), Expect(2) = 0.79 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 851 PPPPXPPPXP 880 PPPP PPP P Sbjct: 271 PPPPPPPPPP 280 >UniRef50_UPI0000DD7BE7 Cluster: PREDICTED: hypothetical protein; n=2; Deuterostomia|Rep: PREDICTED: hypothetical protein - Homo sapiens Length = 280 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP S PP P PPP P PP P Sbjct: 238 PLPPPSSPPPSPSPPPSPSSTPLPPPPP 265 >UniRef50_UPI000069DF41 Cluster: UPI000069DF41 related cluster; n=1; Xenopus tropicalis|Rep: UPI000069DF41 UniRef100 entry - Xenopus tropicalis Length = 132 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP PP P PP Sbjct: 94 PPPPLQPPPPLPPPLQPPPAPPPLQPPPAPP 124 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP PPP P PP P PP Sbjct: 97 PLQPPPPLPPPLQPPPAPPPLQPPPAPPPLQPP 129 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP P PP P PP Sbjct: 86 PPTPQAVQPPPPLQPPPPLPPPLQPPPAPPPLQPP 120 >UniRef50_Q4TB69 Cluster: Chromosome 11 SCAF7190, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 11 SCAF7190, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 452 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 352 PPPPPPLPPPPPPPPPPP-----PPPRPPTCPP 379 >UniRef50_Q6QXJ8 Cluster: ORF55; n=1; Agrotis segetum granulovirus|Rep: ORF55 - Agrotis segetum granulosis virus (AsGV) (Agrotis segetumgranulovirus) Length = 1004 Score = 36.7 bits (81), Expect = 0.84 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P PP P P PP Sbjct: 897 PPTPEPTPPPTPEPTPPPTPEPTPP 921 Score = 36.7 bits (81), Expect = 0.84 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P PP P P PP Sbjct: 905 PPTPEPTPPPTPEPTPPPTPEPTPP 929 Score = 36.7 bits (81), Expect = 0.84 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P PP P P PP Sbjct: 913 PPTPEPTPPPTPEPTPPPTPEPTPP 937 Score = 36.7 bits (81), Expect = 0.84 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P PP P P PP Sbjct: 921 PPTPEPTPPPTPEPTPPPTPEPTPP 945 Score = 36.7 bits (81), Expect = 0.84 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P PP P P PP Sbjct: 929 PPTPEPTPPPTPEPTPPPTPEPTPP 953 Score = 36.7 bits (81), Expect = 0.84 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P PP P P PP Sbjct: 937 PPTPEPTPPPTPEPTPPPTPEPTPP 961 Score = 36.7 bits (81), Expect = 0.84 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P PP P P PP Sbjct: 961 PPTPEPTPAPTPEPTPPPTPEPTPP 985 Score = 33.9 bits (74), Expect = 5.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P+P P P PP P P P Sbjct: 945 PPTPEPTPPPTPEPTPPPTPEPTP 968 Score = 33.5 bits (73), Expect = 7.8 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P P P P PP Sbjct: 953 PPTPEPTPPPTPEPTPAPTPEPTPP 977 >UniRef50_Q2W2A9 Cluster: Periplasmic protein TonB, links inner and outer membranes; n=3; Magnetospirillum|Rep: Periplasmic protein TonB, links inner and outer membranes - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 313 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P+P P P P P P PP Sbjct: 100 PPPTPAPPPPKPEPAPAPIPKPEPKPEPKPEPP 132 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P P PP PPP P PP P PP Sbjct: 77 PPKPEPPKPEPPKPPPPPTPAPPPPPTPAPPPP 109 Score = 34.3 bits (75), Expect = 4.5 Identities = 18/60 (30%), Positives = 18/60 (30%), Gaps = 1/60 (1%) Frame = +1 Query: 745 PXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P P P P P P P P PP P P P Sbjct: 82 PPKPEPPKPPPPPTPAPPPPPTPAPPPPKPEPAPAPIPKPEPKPEPKPEPPPPPKPEPRP 141 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP + PPPP P P P P P P Sbjct: 98 PPPPPTPAPPPPKPEPAPAPIPKPEPKPEPKP 129 >UniRef50_Q0M4S1 Cluster: TonB-like; n=1; Caulobacter sp. K31|Rep: TonB-like - Caulobacter sp. K31 Length = 245 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P P Sbjct: 69 PPPPPPPPPPPPPPPPPPTNAPPPPPAVVQP 99 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPPP PPP P PP Sbjct: 69 PPPPPPPPPPPPPPPPPPTNAPPPP 93 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP PP Sbjct: 70 PPPPPPPPPPPPPPPPPTNAPPPPPAVVQPRPP 102 >UniRef50_Q0LTW4 Cluster: Peptidase M56, BlaR1 precursor; n=1; Caulobacter sp. K31|Rep: Peptidase M56, BlaR1 precursor - Caulobacter sp. K31 Length = 596 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P P Sbjct: 382 PPPPAPPPPPAPPPPPPAPPAPPAPPAPPAP 412 Score = 35.9 bits (79), Expect = 1.5 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +1 Query: 724 LSSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPX 903 LSS PP P PP P P PP P P P P P P Sbjct: 350 LSSIPAPPEPPAPP--APPEPAESAEAMTLALLPPPPPAPPPPPAPPPPPPAPPAPPAPP 407 Query: 904 XPXPXPP 924 P PP Sbjct: 408 APPAPPP 414 >UniRef50_A5NQH0 Cluster: Putative uncharacterized protein precursor; n=1; Methylobacterium sp. 4-46|Rep: Putative uncharacterized protein precursor - Methylobacterium sp. 4-46 Length = 462 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP P P P PP P PP Sbjct: 313 PPPEPAPPPPPPVPEPVPEAAAPPPHHPEPEPP 345 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P + PP P P P P P P P P P Sbjct: 403 PAPEPVPPPPEPEPEPEPPPPPPPAPEPEPEP 434 >UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; Saccharopolyspora erythraea NRRL 2338|Rep: Putative uncharacterized protein - Saccharopolyspora erythraea (strain NRRL 23338) Length = 373 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PPPP PPP P PP P P Sbjct: 269 PPPTPEPVPPPPIPPPPPVPAPPPPPEPAPVP 300 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P P P PP Sbjct: 277 PPPPIPPPPPVPAPPPPPEPAPVPGVPPAADPP 309 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP--XXXXXPPXXPXXXPP 925 P PP PPPP P P P PP P PP Sbjct: 283 PPPPVPAPPPPPEPAPVPGVPPAADPPPAPSPPPP 317 >UniRef50_A3Q1Z8 Cluster: Molecular chaperone-like; n=4; Mycobacterium|Rep: Molecular chaperone-like - Mycobacterium sp. (strain JLS) Length = 568 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPX---PPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 508 PPPPAQEPPPPPPAEEPPPPPPAEEPPPPPPTTQPP 543 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPX---PPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP P PP P PP Sbjct: 499 PPPAATEAPPPPPAQEPPPPPPAEEPPPPPPAEEPP 534 >UniRef50_A1UKQ7 Cluster: Putative uncharacterized protein; n=3; Mycobacterium|Rep: Putative uncharacterized protein - Mycobacterium sp. (strain KMS) Length = 317 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPXP---PPXPXXXXXPPXXPXXXPP 925 P PP PPPP P PP P PP P PP Sbjct: 13 PPPPQGGYPPPPPPGGYPPPPTQGGYPPPHPGGYPP 48 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPP---XPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 5 PPPPPGNYPPPPQGGYPPPPPPGGYPPPPTQGGYPP 40 >UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1289 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP S PPP PPP P PP P Sbjct: 947 PPPPPSYGSPPPPPPPPPSYGSPPPPPP 974 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP S PPP PPP P PP P Sbjct: 960 PPPPPSYGSPPPPPPPPPGYGSPPPPPP 987 Score = 35.1 bits (77), Expect = 2.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPP PPP P PP P Sbjct: 973 PPPPPGYGSPPPPPPPPPSYGSPPPPPP 1000 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP PP P Sbjct: 935 PPPPSYGSPPPPPPPPPSYGSPPPPPPP 962 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP PP P Sbjct: 948 PPPPSYGSPPPPPPPPPSYGSPPPPPPP 975 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP PP P Sbjct: 974 PPPPGYGSPPPPPPPPPSYGSPPPPPPP 1001 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP PP P Sbjct: 987 PPPPSYGSPPPPPPPPFSHVSSIPPPPP 1014 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP PP P Sbjct: 961 PPPPSYGSPPPPPPPPPGYGSPPPPPPP 988 Score = 26.2 bits (55), Expect(2) = 8.0 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 854 PPPXPPPXPXXXXXPPXXPXXXPP 925 PPP PPP P P PP Sbjct: 689 PPPPPPPPPFSSERPNSGTVLPPP 712 Score = 25.8 bits (54), Expect(2) = 8.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 851 PPPPXPPPXP 880 PPPP PPP P Sbjct: 648 PPPPPPPPLP 657 >UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Extensin - Volvox carteri Length = 464 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP P P PP P PP Sbjct: 368 PPPPRASPPPPPASSPPPPPRPPPPSPPPSPPP 400 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPX-PPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP PP Sbjct: 376 PPPPASSPPPPPRPPPPSPPPSPPPPATAAANPP 409 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P P P P PP P P PP Sbjct: 291 PPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPP 323 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP PP Sbjct: 301 PPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPP 333 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP PP Sbjct: 329 PSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPP 361 Score = 34.3 bits (75), Expect = 4.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP P P PP P PP Sbjct: 360 PPPVVSPPPPPPRASPPPPPASSPPPPPRPPPP 392 >UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassified, expressed; n=5; Oryza sativa|Rep: Transposon protein, putative, unclassified, expressed - Oryza sativa subsp. japonica (Rice) Length = 892 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPP 379 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P PP Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP P P PP Sbjct: 342 PVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPP 374 >UniRef50_O23374 Cluster: P140mDia like protein; n=2; Arabidopsis thaliana|Rep: P140mDia like protein - Arabidopsis thaliana (Mouse-ear cress) Length = 645 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPP PPP P PP PP Sbjct: 310 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPP 342 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PP P PPP P PP PP Sbjct: 311 PPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPP 343 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 832 PXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P PP P +P P P PP P P PP Sbjct: 305 PGRSAPPPPPAAAPPPQPPPPPPPKPQPPPP 335 >UniRef50_O23370 Cluster: Cell wall protein like; n=15; Magnoliophyta|Rep: Cell wall protein like - Arabidopsis thaliana (Mouse-ear cress) Length = 428 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPP--XPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 98 PPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPP 132 Score = 35.1 bits (77), Expect = 2.6 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P + PP P P P P P P P Sbjct: 78 PPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYT 137 Query: 922 P 924 P Sbjct: 138 P 138 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P PP P PP Sbjct: 82 PKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPP 114 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P PP P PP Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPP 122 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P PP P PP Sbjct: 122 PPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPP 154 >UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole genome shotgun sequence; n=4; Magnoliophyta|Rep: Chromosome chr1 scaffold_135, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 673 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP S PPP PPP P PP P Sbjct: 69 PPPPKSESPPPTPPPPSPSPPPPPPPPP 96 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPP PPP P PP P Sbjct: 79 PTPPPPSPSPPPPPPPPPSSGSGPPKPP 106 Score = 34.3 bits (75), Expect = 4.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP PPP PP P PP Sbjct: 92 PPPPPSSGSGPPKPPPPSHSNSSPPPPPTSPPP 124 >UniRef50_A5BD28 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 283 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP PP P PP Sbjct: 46 PPPXPPPPPPPPPPIDPDCPPPPVDPPIVPP 76 >UniRef50_Q55FU3 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 354 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P PP P PP Sbjct: 105 SNIPPPPPPPPPPMTGVPPPPPPPPPPP 132 >UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing protein; n=2; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1139 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP PP P P Sbjct: 540 PPPPPGLVPPPPPPPPGASLVPPPPPPPPGAP 571 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPP PPP PP P PP Sbjct: 618 PPPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPP 650 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP--XPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 529 PPPPSGTAPPPPPPPPGLVPPPPPPPPGASLVPPP 563 >UniRef50_A2F4E1 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 479 Score = 36.7 bits (81), Expect = 0.84 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP + PPPP PPP P PP Sbjct: 361 PPPPAAAAPPPPPPPPPPAGLPPPP 385 >UniRef50_A2DI20 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 460 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P+P P P PP P P PP Sbjct: 341 PPPPPAPAAPPPPPAPAAPPPPPPPSVPAPPPP 373 >UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 1084 Score = 36.7 bits (81), Expect = 0.84 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP--XXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 541 PNPPQIAPPPPPPPPPPPPGGLLTAPPPPPPPPPP 575 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 827 PXPPXSXXPP----PPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP PP PPP P PP P PP Sbjct: 585 PPPPPPPPPPGGRLPPPPPPPPGGMPPPPPMPGRAPP 621 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 548 PPPP----PPPPPPPPGGLLTAPPPPPPPPPPP 576 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P PP Sbjct: 566 PPPP----PPPPPPPPPGGSLTAPPPPPPPPPP 594 >UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2; Coccidioides|Rep: Proline-and threonine-rich protein - Coccidioides posadasii Length = 281 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 100 PPPPPPPPPPPPPPAPTTTQAPQYPPPPPPP 130 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP-PXPXXXXXPPXXPXXXP 922 P PP PPPP PP P P PP P P Sbjct: 143 PPPPPPPPPPPPAPPAPKPSKPAPPPQPPTELP 175 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P PP Sbjct: 99 PPPPPPPPPPPPPPPAPTTTQAPQYPPPPPP 129 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PPPP PPP P P P PP Sbjct: 121 PQYPPPPPPPPPPAPTTSKAAPPPPPPPPP 150 >UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 205 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P + PP P P P P PP P P PP Sbjct: 110 PPPTTVVPPPPPPPPPTHTTHPHPPPPPPPPPP 142 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP PPP P P PP Sbjct: 109 PPPPTTVVPPPPPPPPPTHTTHPHPPPPPPPPP 141 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPP PPP P P P PP Sbjct: 108 PPPPPTTVVPPPPPPPPPTHTTHPHPPPPPPPP 140 Score = 33.9 bits (74), Expect = 5.9 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P P PP P P P Sbjct: 105 PPPPPPPPTTVVPPPPPPPPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPPPPPPPPPPP 164 Query: 922 P 924 P Sbjct: 165 P 165 >UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1723 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PPPP PPP P PP P PP Sbjct: 1023 PGFGGPPPPPPPPPPPGMPGMPPPPPPPPPP 1053 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P P P PP Sbjct: 1020 PVAPGFGGPPPPPPPPPPPGMPGMPPPPPPPPP 1052 >UniRef50_Q03209 Cluster: 61 kDa protein; n=6; Nucleopolyhedrovirus|Rep: 61 kDa protein - Autographa californica nuclear polyhedrosis virus (AcMNPV) Length = 543 Score = 36.7 bits (81), Expect = 0.84 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP + PPPP PPP P PP Sbjct: 271 PKPPSASPPPPPPPPPPPAPPAPPP 295 >UniRef50_Q9QYX7 Cluster: Protein piccolo; n=22; cellular organisms|Rep: Protein piccolo - Mus musculus (Mouse) Length = 5038 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P PP P PP Sbjct: 2302 SAQPPPPPPPPPPPPPPPPPPPPPPLPP 2329 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P Sbjct: 2305 PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2336 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PP P PP P Sbjct: 2312 PPPPPPPPPPPPPPPLPPATSPKPPTYP 2339 >UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|Rep: Inverted formin-2 - Mus musculus (Mouse) Length = 1273 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 469 PPPPPPPPPPLPPPLPGSGTISPPPPPPPPP 499 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 449 PLPP----PPPPLPPPLPGSGTTSPPPPPPPPP 477 >UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific; n=287; cellular organisms|Rep: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific - Mus musculus (Mouse) Length = 440 Score = 36.7 bits (81), Expect = 0.84 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PPPP PPP P PP P P Sbjct: 46 PPPTVEEQPPPPPPPPPPPPPPPPPPPPQIEP 77 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPQIEPDKFEEAPPP 86 Score = 33.9 bits (74), Expect = 5.9 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP------XXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPP 93 >UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to formin 1,2/cappuccino - Nasonia vitripennis Length = 1271 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PPPP PPP P PP P P Sbjct: 589 PMPEMMSGPPPPPPPPMPGMMSGPPPPPPPIP 620 >UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 972 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP P P PP P PP Sbjct: 841 PQPPVTRPPPPPPTRPPPPPPTRPPPPPPTRPP 873 >UniRef50_UPI00015056F9 Cluster: DNA binding / ligand-dependent nuclear receptor; n=1; Arabidopsis thaliana|Rep: DNA binding / ligand-dependent nuclear receptor - Arabidopsis thaliana Length = 359 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP P P P PP P PP Sbjct: 157 PPPSPKKSPPPPKPSPSPPKPSTPPPTPKKSPP 189 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP P P P PP P PP Sbjct: 197 PPPSPKKSPPPPKPSPSPPKPSTPPPTPKKSPP 229 >UniRef50_UPI0000F2B900 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 113 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 18 GGGGGGGGGGDGDGDGGGGGGGGGGGGSGGGGG 50 >UniRef50_UPI0000E21CCC Cluster: PREDICTED: similar to BAI 1, partial; n=1; Pan troglodytes|Rep: PREDICTED: similar to BAI 1, partial - Pan troglodytes Length = 635 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP PP Sbjct: 458 PPAQPPPPPPPPPPPPQQPLPPPPNLEPAPP 488 Score = 33.5 bits (73), Expect = 7.8 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P P + PPPP PPP P PP Sbjct: 455 PEAPPAQPPPPPPPPPPPPQQPLPP 479 >UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 311 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 205 GGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGG 237 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 206 GGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGG 238 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 211 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 212 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 213 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 214 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 215 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 216 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 217 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 186 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 218 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 187 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 219 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 220 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 189 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 221 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 190 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 222 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 191 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 223 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 192 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 224 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 193 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 225 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 194 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 226 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 195 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 227 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 196 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 228 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 197 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 229 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 198 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 230 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 199 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 231 >UniRef50_UPI00015A5F90 Cluster: WAS protein homology region 2 domain containing 1; n=2; Danio rerio|Rep: WAS protein homology region 2 domain containing 1 - Danio rerio Length = 735 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXP 910 PP + PPPP PPP P PP P Sbjct: 572 PPLAPPPPPPAPPPPPAPLAPPPAPP 597 >UniRef50_Q4THH6 Cluster: Chromosome undetermined SCAF2934, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF2934, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 300 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXP 910 PP + PPPP PPP P PP P Sbjct: 261 PPPAPPPPPPPPPPPPPTPPPPPPPP 286 Score = 35.5 bits (78), Expect = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXP 910 PP PPPP PPP P PP P Sbjct: 262 PPAPPPPPPPPPPPPPTPPPPPPPPP 287 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P S PPP PPP P PP P PP Sbjct: 254 PTRSYTNPPPAPPPPPPPPPPPPPTPPPPPP 284 Score = 33.5 bits (73), Expect = 7.8 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +1 Query: 703 PXARCGXLSSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXX 882 P R G L PP P PP P PP P P P Sbjct: 218 PVTRSGRLCP---PPCPPSPPDCLRGSLTISRIRTRVRA--PTRSYTNPPPAPPPPPPPP 272 Query: 883 PXPXPPXXPXPXPP 924 P P P P P PP Sbjct: 273 PPPPPTPPPPPPPP 286 >UniRef50_Q4SHS7 Cluster: Chromosome 5 SCAF14581, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 5 SCAF14581, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 789 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PP P PPP P PP P PP Sbjct: 635 PPPATATCPPVPPPPPPPPPPPPPPPMPPTVPP 667 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP PPPP PPP P PP P Sbjct: 647 PPPPPPPPPPPPPPMPPTVPPPPVSSEDVP 676 >UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 14 SCAF15003, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1140 Score = 36.3 bits (80), Expect = 1.1 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXP--XPPXXPXP 915 PP P PP P P + PP P P P P P PP P Sbjct: 533 PPLVPGPPGGPLPPPPLPCFAGLAPPPPPLPGAMMPPPPPPPPPPGGPPPPGRPPVSGVP 592 Query: 916 XPP 924 PP Sbjct: 593 PPP 595 >UniRef50_Q8UZB6 Cluster: Replicase; n=5; Grapevine fleck virus|Rep: Replicase - Grapevine fleck virus Length = 1949 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PPP P PP P P Sbjct: 686 PLPPAPPLPPQPPPPPPPQPSPHPPLFPASIP 717 >UniRef50_Q197B3 Cluster: Putative uncharacterized protein; n=1; Aedes taeniorhynchus iridescent virus|Rep: Putative uncharacterized protein - Aedes taeniorhynchus iridescent virus Length = 407 Score = 36.3 bits (80), Expect = 1.1 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P PP P P P P P PP P P P Sbjct: 275 PQPKPQPPPDPPKPPPDPPKPDPPPPPPPKPTPPPDPPKPKPDPVPPPKPTPP-PPKPTP 333 Query: 922 P 924 P Sbjct: 334 P 334 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PP P PP P PP Sbjct: 297 PPPPPPPKPTPPPDPPKPKPDPVPPPKPTPPPP 329 Score = 33.5 bits (73), Expect = 7.8 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P P P P P P P P P P P Sbjct: 279 PQPPPDPPKPPPDPPKPDPPPPPPPKPTPPPDPPKPKPDPVPPPKPTPPPPKPTPPPPIP 338 Query: 922 P 924 P Sbjct: 339 P 339 >UniRef50_Q6PB68 Cluster: Bai1 protein; n=8; Euteleostomi|Rep: Bai1 protein - Mus musculus (Mouse) Length = 524 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP PP Sbjct: 347 PPVQPPPPPPPPPPPPQQPIPPPPTLEPAPP 377 >UniRef50_Q3M5H7 Cluster: VCBS; n=2; Bacteria|Rep: VCBS - Anabaena variabilis (strain ATCC 29413 / PCC 7937) Length = 6581 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P + PP P P P P PP P P PP Sbjct: 2222 PIPIPIPPPPPPPPPIPPRPEPPPPIPPRPEPP 2254 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSP-XXXPXPXPPXXPXPXPP 924 P P + PP P P P P P PP P P PP Sbjct: 2211 PIPIPIPIPPIPIPIPIPPPPPPPPPIPPRPEPP 2244 >UniRef50_A6G1X8 Cluster: Single-stranded DNA-binding protein; n=1; Plesiocystis pacifica SIR-1|Rep: Single-stranded DNA-binding protein - Plesiocystis pacifica SIR-1 Length = 198 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 123 GGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGG 155 >UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: F24O1.6 - Arabidopsis thaliana (Mouse-ear cress) Length = 70 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP PP P PP Sbjct: 10 PPPFHHPPPPRPPPPEPRPPPPPPGPQPPPP 40 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P P PPP P PP P PP Sbjct: 16 PPPPRPPPPEPRPPPPPPGPQPPPPPPPRPDPP 48 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P P PP PPP P PP P PP Sbjct: 18 PPRPPPPEPRPPPPPPGPQPPPPPPPRPDPPPP 50 >UniRef50_Q69XV3 Cluster: Putative glycine-rich cell wall structural protein; n=3; Oryza sativa|Rep: Putative glycine-rich cell wall structural protein - Oryza sativa subsp. japonica (Rice) Length = 321 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 126 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRG 122 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 125 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 127 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 128 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 101 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 105 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 107 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 108 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 109 GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 110 GGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 111 GGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 114 GGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 115 GGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 117 GGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNG 149 >UniRef50_Q0J2H9 Cluster: Os09g0341100 protein; n=8; Oryza sativa|Rep: Os09g0341100 protein - Oryza sativa subsp. japonica (Rice) Length = 704 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPP P P P PP P PP Sbjct: 170 PPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPP 202 >UniRef50_Q0DME4 Cluster: Os03g0813200 protein; n=4; Oryza sativa|Rep: Os03g0813200 protein - Oryza sativa subsp. japonica (Rice) Length = 478 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCG 72 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 55 GGGGGGGGGGGGSGGGCGGGGGGGGGSSGGG 85 >UniRef50_Q08194 Cluster: Cysteine-rich extensin-like protein-1; n=4; Nicotiana tabacum|Rep: Cysteine-rich extensin-like protein-1 - Nicotiana tabacum (Common tobacco) Length = 209 Score = 36.3 bits (80), Expect = 1.1 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P PP P P P P P P P P P Sbjct: 62 PPPWPCPPPRPRPRPRPCPSPPPPPRPRPCPSP-PPPPRPRPCPSPPPPPQPRPRPSPPP 120 Query: 922 P 924 P Sbjct: 121 P 121 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P P P P PP P P P Sbjct: 61 PPPPWPCPPPRPRPRPRPCPSPPPPPRPRPCP 92 >UniRef50_A2XZD2 Cluster: Putative uncharacterized protein; n=2; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 601 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXP 910 PP + PPPP PPP P PP P Sbjct: 71 PPLAASPPPPPPPPPPRNSPSPPKPP 96 >UniRef50_Q57WJ7 Cluster: Calpain, putative; n=3; Trypanosoma brucei|Rep: Calpain, putative - Trypanosoma brucei Length = 888 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPP PPP P PP P P Sbjct: 17 PPPPPPVVAPPPPPPPPPPEPVAPPTPPPKSP 48 >UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: Formin B - Trypanosoma cruzi strain CL Brener Length = 968 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P PP Sbjct: 476 PPPPGKNAPPPPPPPPPPPPHGKKAPPPPPPPP 508 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP PPPP PPP PP P P Sbjct: 466 PPPRTPPPPPPPPPGKNAPPPPPPPPPPPP 495 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PPPP PPP PP P PP Sbjct: 466 PPPRTPPPPPPPPPGKNAPPPPPPPPPPPP 495 >UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1027 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPP PPP P PP P P Sbjct: 432 PPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPP 463 Score = 35.9 bits (79), Expect = 1.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 419 PPPPPGGVPPPP-PPPPPGMGGAPPPPPPPPP 449 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP PP P PP Sbjct: 460 PPPPGPGGGPPPPPPPPGGGPPGPPPPPAQLPP 492 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPP PPP P PP P Sbjct: 446 PPPPGMGGGPPPPPPPPPGPGGGPPPPP 473 >UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 404 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPPP PPP P PP Sbjct: 341 PPPPGGAGPPPPPPPPPPGLPAPPP 365 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPP PPP P PP P Sbjct: 340 PPPPPGGAGPPPPPPPPPPGLPAPPPPP 367 >UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 2195 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPPP PPP P PP Sbjct: 952 PPPPGGAGPPPPPPPPPPGLPAPPP 976 Score = 34.7 bits (76), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPP PPP P PP P Sbjct: 951 PPPPPGGAGPPPPPPPPPPGLPAPPPPP 978 >UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 634 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PPPP PPP P PP P P Sbjct: 550 PPPVPGNAPPPPPPPPPPPGAGAPPPPPPPGP 581 >UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1128 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P PP Sbjct: 598 PPPPVGAPPPPPPPPPPPPGVAAAAPPPPPPPP 630 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P PP Sbjct: 597 PPPPPVGAPPPPPPPPPPPPGVAAAAPPPPPPP 629 >UniRef50_Q2HEQ9 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 438 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 376 GGGGRGGGGGGRGGGGGGGGRGGGGGGRGGGGG 408 >UniRef50_P50552 Cluster: Vasodilator-stimulated phosphoprotein; n=21; Euteleostomi|Rep: Vasodilator-stimulated phosphoprotein - Homo sapiens (Human) Length = 380 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P P P P Sbjct: 163 PAPPAGGPPPPPGPPPPPGPPPPPGLPPSGVP 194 >UniRef50_P48023 Cluster: Tumor necrosis factor ligand superfamily member 6 (Fas antigen ligand) (Fas ligand) (CD178 antigen) (CD95L protein) (Apoptosis antigen ligand) (APTL) [Contains: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, soluble form]; n=33; Fungi/Metazoa group|Rep: Tumor necrosis factor ligand superfamily member 6 (Fas antigen ligand) (Fas ligand) (CD178 antigen) (CD95L protein) (Apoptosis antigen ligand) (APTL) [Contains: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, soluble form] - Homo sapiens (Human) Length = 281 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 832 PXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P PP P P P P P PP P P PP Sbjct: 40 PGQRRPPPPPPPPPLPPPPPPPPLPPLPLPP 70 >UniRef50_Q70E73 Cluster: Ras-associated and pleckstrin homology domains-containing protein 1; n=21; Amniota|Rep: Ras-associated and pleckstrin homology domains-containing protein 1 - Homo sapiens (Human) Length = 1302 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P Sbjct: 676 PSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAP 707 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P + P PP PPP P PP P PP Sbjct: 670 PYTASQPSPPLPPPPPPPPPPPPPPPPPPPP 700 >UniRef50_Q96S59 Cluster: Ran-binding protein 9; n=51; Euteleostomi|Rep: Ran-binding protein 9 - Homo sapiens (Human) Length = 729 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP PPP P P PP Sbjct: 74 PPPPATAAPPPPPPPPPPPASAAAPASGPPAPP 106 >UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda|Rep: Protein enabled homolog - Homo sapiens (Human) Length = 591 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP PPP PP P PP Sbjct: 339 PPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPP 371 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 338 PPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 370 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP P P PP P PP Sbjct: 332 PPPGPPPPPPLPSTGPPPPPPPPPLPNQVPP 362 >UniRef50_O14514 Cluster: Brain-specific angiogenesis inhibitor 1 precursor; n=25; Euteleostomi|Rep: Brain-specific angiogenesis inhibitor 1 precursor - Homo sapiens (Human) Length = 1584 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP PP Sbjct: 1407 PPAQPPPPPPPPPPPPQQPLPPPPNLEPAPP 1437 Score = 33.5 bits (73), Expect = 7.8 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P P + PPPP PPP P PP Sbjct: 1404 PEAPPAQPPPPPPPPPPPPQQPLPP 1428 >UniRef50_Q7Z5R6 Cluster: Amyloid beta A4 precursor protein-binding family B member 1- interacting protein; n=34; Euteleostomi|Rep: Amyloid beta A4 precursor protein-binding family B member 1- interacting protein - Homo sapiens (Human) Length = 666 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP PP Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPP 579 >UniRef50_A7QQ26 Cluster: Chromosome chr2 scaffold_140, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr2 scaffold_140, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 1163 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP + PPPP PPP P P PP Sbjct: 557 PPSTSTPPPPPPPPISSNKAPSPPPPPPPPP 587 Score = 31.1 bits (67), Expect(2) = 1.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P S PPPP PPP P Sbjct: 599 PPTPASRGPPPPPPPPPP 616 Score = 23.8 bits (49), Expect(2) = 1.3 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +2 Query: 857 PPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP P P PP Sbjct: 631 PPPPPPPPDFSSSSSNKPTLPPP 653 >UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 protein; n=2; Danio rerio|Rep: PREDICTED: similar to LOC495114 protein - Danio rerio Length = 904 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP P PP Sbjct: 319 PPPPPPPPGPAGLFSPPPPPPPPPP 343 >UniRef50_UPI0000F1E76D Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 524 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P +P P P PP P P PP Sbjct: 155 PKPLSPIKPPTPRQTPPPKPSPPPPPIPTPVPP 187 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PP P PPP P PP P P Sbjct: 163 PPTPRQTPPPKPSPPPPPIPTPVPPPSPPKQP 194 >UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 1032 Score = 35.9 bits (79), Expect = 1.5 Identities = 20/66 (30%), Positives = 22/66 (33%) Frame = +1 Query: 727 SSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXX 906 S+ PP P PP P P PP P P+P P PP Sbjct: 906 SAPGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPP-----PPGPPPAPDAALPPPPPAP 960 Query: 907 PXPXPP 924 P P PP Sbjct: 961 PPPGPP 966 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP P P P P P PP Sbjct: 930 PPPPQAALPPPPPPGPPPAPDAALPPPPPAPPP 962 Score = 34.7 bits (76), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P P PPP P PP P PP Sbjct: 915 PPPPLLSEAPLPPPPPPPPQAALPPPPPPGPPP 947 >UniRef50_Q8BEN8 Cluster: ORF58; n=1; Callitrichine herpesvirus 3|Rep: ORF58 - Callitrichine herpesvirus 3 (Marmoset lymphocryptovirus) Length = 2819 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P P P PP Sbjct: 373 PTPPQPTPPPQPTPPPQPTPPPQPTPPPQPTPP 405 Score = 35.1 bits (77), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP P PPP P P P PP Sbjct: 378 PTPPPQPTPPPQPTPPPQPTPPPQPTPPPQHTPP 411 >UniRef50_Q3UHZ5 Cluster: 17 days embryo heart cDNA, RIKEN full-length enriched library, clone:I920184N14 product:leiomodin 2 (cardiac), full insert sequence; n=16; Tetrapoda|Rep: 17 days embryo heart cDNA, RIKEN full-length enriched library, clone:I920184N14 product:leiomodin 2 (cardiac), full insert sequence - Mus musculus (Mouse) Length = 550 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP PP P PP Sbjct: 421 PPSPVAPPPPPPPPPLPPHMLPPPPPPPAPP 451 >UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2; Vibrio harveyi|Rep: Insecticidal toxin, SepC/Tcc class - Vibrio harveyi HY01 Length = 378 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPP PPP PP P PP Sbjct: 94 PPPPPAGGMPPPPPPPMGGGAPPPPPGPGAPPP 126 >UniRef50_A5G2K8 Cluster: Putative uncharacterized protein; n=1; Acidiphilium cryptum JF-5|Rep: Putative uncharacterized protein - Acidiphilium cryptum (strain JF-5) Length = 320 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP P P P PP Sbjct: 80 PQPKVAPPPPPPPPPPAPHAAPKLPQPPVPPPP 112 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXP-PXXPXXXPP 925 P P PPPP PPP P P P P PP Sbjct: 101 PKLPQPPVPPPPPPPPTPAPTPIPTPPPPPPHPP 134 >UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP3 protein - Volvox carteri f. nagariensis Length = 687 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 600 PSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSP 632 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 610 PSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSP 642 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 615 PNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSP 647 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 620 PSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTP 652 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PP P PPP P PP P PP Sbjct: 495 PSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPP 527 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 833 PPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 PP P PPP PPP P PP P PP Sbjct: 518 PPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPP 549 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 595 PSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSP 627 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 630 PSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRP 662 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PP P PP P PP Sbjct: 635 PNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPP 667 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 638 PPPSPPPPSPRPPTPPPPSPPPPRPPPRPPP 668 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 593 PPPSPPPPSPPPPNPPPPSPPPPNPPPPSPP 623 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 598 PPPSPPPPNPPPPSPPPPNPPPPSPPPPSPP 628 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P P Sbjct: 605 PNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNP 637 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 608 PPPSPPPPNPPPPSPPPPSPPPPSPPPPNPP 638 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PP P PP P PP P PP Sbjct: 628 PPPSPPPPNPPPPSPPPPSPRPPTPPPPSPP 658 Score = 34.3 bits (75), Expect = 4.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP PP P P P PP Sbjct: 500 PTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPP 532 Score = 34.3 bits (75), Expect = 4.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP P P P PP P P Sbjct: 531 PPRPSSPRPPPPDPSPPPPSPPSPPTSPSPPDP 563 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PP P PP P PP Sbjct: 577 PNPP-SPDPPSPDPPSAPPPSPPPPSPPPPNPP 608 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP--XPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 599 PPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPP 633 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + P PP P P P P P PP Sbjct: 587 PDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPP 619 >UniRef50_Q7XAL2 Cluster: Extensin-like protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Extensin-like protein - Oryza sativa subsp. japonica (Rice) Length = 161 Score = 35.9 bits (79), Expect = 1.5 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP PP P PP P PP Sbjct: 120 PPPPDALVPPPP-PPAAPALVTPPPALPSAPPP 151 >UniRef50_Q41192 Cluster: NaPRP3; n=1; Nicotiana alata|Rep: NaPRP3 - Nicotiana alata (Winged tobacco) (Persian tobacco) Length = 151 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 82 PPPPSPSPPPPSPPPPSPSPPPPSPSPPPPSPP 114 >UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=2; Ostreococcus|Rep: RhoA GTPase effector DIA/Diaphanous - Ostreococcus tauri Length = 1105 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P P P P Sbjct: 470 PPPPPPPPPPPPPPPPRPSLGPIVPTPPAPPP 501 >UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 17 contig 1, DNA sequence - Ostreococcus tauri Length = 281 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P P PP P P PP Sbjct: 113 PPPPSPPPPSPPPPSPPSPPPPSPP 137 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PP P PP P PP Sbjct: 115 PPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPP 147 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP PP Sbjct: 123 PPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPP 155 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PPPP PPP PP P PP Sbjct: 114 PPPS--PPPPSPPPPSPPSPPPPSPPPPSPP 142 Score = 33.9 bits (74), Expect = 5.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP--XPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 118 PPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPP 152 Score = 33.5 bits (73), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PPP P P P PP Sbjct: 113 PPPPSPPPPSPPPPSPPSPPPPSPPPPSPPP 143 >UniRef50_O48809 Cluster: T3P18.1; n=9; Eukaryota|Rep: T3P18.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 786 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP PP P PP Sbjct: 489 PPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 519 >UniRef50_A7QHZ4 Cluster: Chromosome chr17 scaffold_101, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr17 scaffold_101, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 131 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PPP P PP P PP Sbjct: 77 PPSMALLPPPPPPPPPPPSSPPPIPPSPPPP 107 Score = 34.3 bits (75), Expect = 4.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P L PP P P P P P PP P P P Sbjct: 78 PSMALLPPPPPPPPPPPSSPPPIPPSPPPPTSP 110 >UniRef50_A4SBI2 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 357 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP P PP Sbjct: 122 PPPPSPPPNPPPNPPPPSPPPNPPP 146 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP PP P PP Sbjct: 122 PPPPSPPPNPPPNPPPPSPPPNPPPNPPPNPPP 154 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 826 PXPXXLXXPPXPXPS-PXXXPXPXPPXXPXPXPP 924 P P PP P P+ P P P PP P P PP Sbjct: 120 PSPPPPSPPPNPPPNPPPPSPPPNPPPNPPPNPP 153 >UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1074 Score = 35.9 bits (79), Expect = 1.5 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXX--PPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P P P PP Sbjct: 575 PPPPISGGGAPPPPPPPPPPPSGGGAPPPPPPPPP 609 >UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_53, whole genome shotgun sequence - Paramecium tetraurelia Length = 1117 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P P P PP Sbjct: 598 PLPGQKTGPPPPPPPPLPGQKAGAPPPPPPPPP 630 >UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP P PP Sbjct: 312 PPPPPPPPLPNSQAPPPPPPPPPPP 336 Score = 35.9 bits (79), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP PP Sbjct: 374 PPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPP 406 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 326 PPPP----PPPPPPPPIPGQQNPPPPPPPPLP 353 Score = 34.3 bits (75), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P P PPPP PPP P PP P Sbjct: 336 PPIPGQQNPPPPPPPPLPGQQAPPPPPP 363 Score = 33.9 bits (74), Expect = 5.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPPP PPP P P PP Sbjct: 318 PPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPP 350 >UniRef50_Q9C0F0 Cluster: Protein KIAA1713; n=33; Deuterostomia|Rep: Protein KIAA1713 - Homo sapiens (Human) Length = 1652 Score = 35.9 bits (79), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP P PP Sbjct: 1423 PPPPPPPPPPLALPPPPPPPPPLPP 1447 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 1421 PPPPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVP 1455 >UniRef50_Q86UP3 Cluster: Zinc finger homeobox protein 4; n=18; Eukaryota|Rep: Zinc finger homeobox protein 4 - Homo sapiens (Human) Length = 3567 Score = 35.9 bits (79), Expect = 1.5 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP + PPPP PPP P PP P PP Sbjct: 1993 PPPTPPPPPPPPPPPP---PPPPPPPPSAPP 2020 >UniRef50_UPI00015B56FF Cluster: PREDICTED: similar to splicing factor proline- and glutamine-rich; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to splicing factor proline- and glutamine-rich - Nasonia vitripennis Length = 646 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 30 GGGGGGGPGGNPGGGGGGGGGGGGGGGGRGGRG 62 >UniRef50_UPI0000F2E6AE Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 378 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 323 GGGDRGGGGGGGGGGGGGGGGGGGGGGGGGGSG 355 Score = 35.1 bits (77), Expect = 2.6 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 329 GGGGGGGGGGGGGGGGGGGGGGGGGSGLYGGGG 361 >UniRef50_UPI0000F2E662 Cluster: PREDICTED: similar to CBLL1 protein; n=1; Monodelphis domestica|Rep: PREDICTED: similar to CBLL1 protein - Monodelphis domestica Length = 608 Score = 35.5 bits (78), Expect = 1.9 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPPP PPP P PP Sbjct: 444 PLPPPFPPPPPPLPPPPPPPPPPPP 468 >UniRef50_UPI0000F2CE07 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 100 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 38 GGVGGGDGGGGGGGGGGGGGGGGGGDGGGGGGG 70 >UniRef50_UPI0000F2CB43 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 252 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 185 GGAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 217 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 220 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 189 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 221 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 191 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSG 223 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 194 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSGG 224 >UniRef50_UPI0000F2C731 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 443 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 184 GGGGSGGGGGGGGSGGSGGGSGGGGGGGGGGGG 216 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 190 GGGGGGGSGGSGGGSGGGGGGGGGGGGGGGGGG 222 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 194 GGGSGGSGGGSGGGGGGGGGGGGGGGGGGGGSG 226 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 198 GGSGGGSGGGGGGGGGGGGGGGGGGGGSGGG 228 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 193 GGGGSGGSGGGSGGGGGGGGGGGGGGGGGGG 223 >UniRef50_UPI0000F2C6D3 Cluster: PREDICTED: hypothetical protein; n=2; Theria|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 149 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 32 GGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64 >UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1465 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP PP P PP Sbjct: 976 PPPPFPGMTPPPPPPPPGCGPPPPPLPPGIGPP 1008 Score = 33.5 bits (73), Expect = 7.8 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P PP P P P P PP P P Sbjct: 940 PGFVPPPPVVGKAPPPPPLPGMVPPPPPPLPGMAPPPPPPFPGMTPPPPPPPPGCGPPPP 999 Query: 922 P 924 P Sbjct: 1000 P 1000 >UniRef50_UPI0000F1F796 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1493 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXP-PPXPXXXXXPPXXPXXXPP 925 P PP + PPPP PP P PP P PP Sbjct: 851 PPPPQAVPPPPPQAVPPPPLQAVPPPPPPQAVPP 884 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXP--PPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 858 PPPPPQAVPPPPLQAVPPPPPPQAVPPPPPQAVPP 892 >UniRef50_UPI0000E7FB87 Cluster: PREDICTED: similar to class IV POU-homeodomain protein; n=1; Gallus gallus|Rep: PREDICTED: similar to class IV POU-homeodomain protein - Gallus gallus Length = 472 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 254 GGAGGGGGGGGHDGAGGGGGGGGGGGGGGGGGG 286 >UniRef50_UPI0000E48B55 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 153 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 106 GGGSGGTEGGNDGGGGGGGGGGGGGGGGGGGGG 138 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GG G E G G Sbjct: 86 GGTDGGNDGGGGGGGGKGGGGGGSGGTEGGNDG 118 >UniRef50_UPI0000DB75B1 Cluster: PREDICTED: similar to One cut domain family member 2 (Transcription factor ONECUT-2) (OC-2); n=1; Apis mellifera|Rep: PREDICTED: similar to One cut domain family member 2 (Transcription factor ONECUT-2) (OC-2) - Apis mellifera Length = 770 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 295 GGSGGGAVGGAGGGNGNGGGGGGGGGGGGGGGG 327 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 298 GGGAVGGAGGGNGNGGGGGGGGGGGGGGGGGGG 330 >UniRef50_UPI0000DB6FB3 Cluster: PREDICTED: similar to plexus CG4444-PA; n=1; Apis mellifera|Rep: PREDICTED: similar to plexus CG4444-PA - Apis mellifera Length = 2310 Score = 35.5 bits (78), Expect = 1.9 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP + PPPP PPP P P P Sbjct: 1231 PPPPPTVAPPPPPPPPPPPPPPPPSSDP 1258 >UniRef50_UPI0000DB6D2F Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 143 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGG 35 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGG 36 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 5 GGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGG 37 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 6 GGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGG 38 >UniRef50_UPI0000DA32FB Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 236 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 69 GGGVGGGVGGRGRVGGGGGGGGGGGGGGGGGGG 101 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 121 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 122 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 123 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 124 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 126 >UniRef50_UPI0000DA1F29 Cluster: PREDICTED: hypothetical protein; n=3; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 170 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 49 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 50 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 57 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 58 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 59 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 60 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 61 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99 >UniRef50_UPI0000DA1EB9 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 270 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 154 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 186 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 155 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 187 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 156 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 188 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 157 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 189 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 158 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 190 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 159 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 191 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 160 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 192 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 161 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 193 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 162 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 194 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 163 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 195 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 164 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 196 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 165 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 197 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 166 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 168 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 169 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 201 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 170 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 202 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 171 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 203 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 172 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 204 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 173 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 174 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 206 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 175 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 207 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 176 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 208 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 178 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRG 210 >UniRef50_UPI0000D561BD Cluster: PREDICTED: hypothetical protein; n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical protein - Tribolium castaneum Length = 592 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 134 GGGGGGGGGGGGGGFGGGGGLGGGGGIGGGGGG 166 >UniRef50_UPI0000DC1DE1 Cluster: Exocyst complex component 3 (Exocyst complex component Sec6) (rSec6).; n=1; Rattus norvegicus|Rep: Exocyst complex component 3 (Exocyst complex component Sec6) (rSec6). - Rattus norvegicus Length = 160 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 92 GGSEEGLCGGQAKGKGGGGGGGGGGGGGGGGGG 124 >UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 13 SCAF15000, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 307 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PPP P PP P PP Sbjct: 168 PPYFPPPPPLPPPPFPLFPLFPPPPPPPPPP 198 Score = 35.1 bits (77), Expect = 2.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPX----PXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 195 PPPPPFSPPPPPSPPPSLFSPPPFFSPPPSFPPLPPP 231 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P P PPPP PPP P PP P Sbjct: 181 PFPLFPLFPPPPPPPPPPPFSPPPPPSP 208 >UniRef50_Q4RQW5 Cluster: Chromosome 14 SCAF15003, whole genome shotgun sequence; n=4; Eumetazoa|Rep: Chromosome 14 SCAF15003, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1962 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 112 GGGSGGSSGGGGGGGGGGGGGGGGGGGGGGGVG 144 >UniRef50_Q91TR1 Cluster: T32; n=1; Tupaiid herpesvirus 1|Rep: T32 - Tupaiid herpesvirus 1 (strain 1) (TuHV-1) (Herpesvirus tupaia (strain1)) Length = 718 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 678 GGGGGGAGGGGGGGGGGGGGGGGGGSGGDGGAG 710 >UniRef50_Q8VAY0 Cluster: Wsv239; n=1; Shrimp white spot syndrome virus|Rep: Wsv239 - White spot syndrome virus (WSSV) Length = 127 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPP--XPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP P P P PP P PP Sbjct: 65 PPPPPSPPPPPPFVVPVPFPFVPPPPPSPPPPPPP 99 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 36 PFPPPFVPPPPPSPPP-PPPFVVPEPFPFVPPP 67 Score = 33.9 bits (74), Expect = 5.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP P P PP PP Sbjct: 43 PPPPPSPPPPPPFVVPEPFPFVPPPPPSPPPPP 75 >UniRef50_Q8QKX8 Cluster: EsV-1-144; n=1; Ectocarpus siliculosus virus 1|Rep: EsV-1-144 - Ectocarpus siliculosus virus 1 Length = 698 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 466 GGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGG 498 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 470 GGGGGGGTGGAGGGGGGGGGGGGGGGGGGGGGG 502 >UniRef50_Q4A2U2 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 858 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PP P PP P PP Sbjct: 750 PPTPLFPPPPPPTSPPPPTPLQPPPQQPSPSPP 782 >UniRef50_Q92NU7 Cluster: PUTATIVE GLYCINE-RICH PROTEIN; n=4; Sinorhizobium|Rep: PUTATIVE GLYCINE-RICH PROTEIN - Rhizobium meliloti (Sinorhizobium meliloti) Length = 233 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 100 GGKGGGSKGGGGVGGGGGGGGGGGGGGGGGGGG 132 Score = 34.7 bits (76), Expect = 3.4 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG + GG G Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGDNGGGG 144 Score = 34.3 bits (75), Expect = 4.5 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGDNGGG 143 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 108 GGGGVGGGGGGGGGGGGGGGGGGGGGGGGGG 138 Score = 33.5 bits (73), Expect = 7.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGDNGGGG 144 >UniRef50_Q127H7 Cluster: Putative uncharacterized protein precursor; n=1; Polaromonas sp. JS666|Rep: Putative uncharacterized protein precursor - Polaromonas sp. (strain JS666 / ATCC BAA-500) Length = 261 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 207 GGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGG 239 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 211 GGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGG 243 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 219 GGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGG 251 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 220 GGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 252 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 221 GGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 253 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 224 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 256 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 225 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 257 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 226 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 258 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 227 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 259 >UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subunit p20 precursor; n=3; Bradyrhizobiaceae|Rep: Peptidase C14, caspase catalytic subunit p20 precursor - Rhodopseudomonas palustris (strain BisA53) Length = 1067 Score = 35.5 bits (78), Expect = 1.9 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPPP PPP P PP Sbjct: 1027 PPPPVVRPPPPPPPPPPPAARPAPP 1051 Score = 35.1 bits (77), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP PP Sbjct: 933 PPPPPVVRPPPPPPPPAAHPAPPPPVVRPAPPP 965 Score = 35.1 bits (77), Expect = 2.6 Identities = 17/61 (27%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P + PP P P+ P P PP P P Sbjct: 957 PVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPP 1016 Query: 922 P 924 P Sbjct: 1017 P 1017 Score = 33.9 bits (74), Expect = 5.9 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P + PP P P+ P P PP P PP Sbjct: 1006 PPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPP 1038 Score = 33.5 bits (73), Expect = 7.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +2 Query: 827 PXPPXSXXPPPPXP------PPXPXXXXXPPXXPXXXPP 925 P PP PPPP P PP P PP P PP Sbjct: 1005 PPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPPPP 1043 >UniRef50_A1TJK5 Cluster: Putative uncharacterized protein; n=4; Proteobacteria|Rep: Putative uncharacterized protein - Acidovorax avenae subsp. citrulli (strain AAC00-1) Length = 1335 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 1297 GGGAPGAAGGGGGDGGGGGGGGGGGGGGGGGGG 1329 >UniRef50_A0YZF2 Cluster: Putative uncharacterized protein; n=2; Lyngbya sp. PCC 8106|Rep: Putative uncharacterized protein - Lyngbya sp. PCC 8106 Length = 305 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 269 GGSGGGEAGGGGGGGGGGGGGGGGGGGGGGGGG 301 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 272 GGGEAGGGGGGGGGGGGGGGGGGGGGGGGGGGG 304 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 273 GGEAGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 305 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 326,928,425 Number of Sequences: 1657284 Number of extensions: 5198730 Number of successful extensions: 205565 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 31429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105541 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 85260991088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -