BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G23 (928 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 39 0.005 08_01_0059 - 394001-394708 39 0.005 03_01_0515 - 3864796-3865425 39 0.005 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 39 0.005 12_02_1174 - 26696869-26698191 39 0.006 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 38 0.009 07_01_0080 + 587674-588510 38 0.011 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 37 0.026 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 37 0.026 09_02_0543 + 10427321-10428315,10428440-10429154 36 0.035 06_03_0790 - 24636805-24637770 36 0.035 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 36 0.035 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 36 0.035 02_04_0400 - 22608519-22608844,22609044-22609122 36 0.035 07_03_0560 + 19479597-19480667 36 0.046 02_05_0686 - 30900748-30902167,30903442-30904742 36 0.046 09_04_0506 - 18188785-18190599 36 0.060 07_03_0558 + 19461369-19462448 36 0.060 07_03_0177 - 14770777-14772045 36 0.060 07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428... 36 0.060 06_03_1326 - 29355467-29355817 36 0.060 03_01_0023 + 198414-198968 36 0.060 01_01_0570 - 4231100-4232560 36 0.060 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 36 0.060 03_05_0576 + 25765137-25766420 35 0.080 01_05_0490 + 22672241-22674679 30 0.089 12_01_0838 - 7830944-7831444 35 0.11 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 35 0.11 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 34 0.14 07_03_0559 + 19475893-19476783 34 0.14 08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384,748... 34 0.18 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 34 0.18 04_04_1582 - 34590698-34591199,34593849-34594690 34 0.18 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 30 0.20 12_02_0299 - 17051570-17052474,17053542-17053755 33 0.24 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 33 0.24 07_03_1751 - 29215074-29216270 33 0.24 07_03_0890 - 22332768-22333382 33 0.24 06_03_0310 - 19453047-19453160,19453240-19453338,19453441-194535... 33 0.24 06_02_0175 - 12624608-12625297 33 0.24 04_04_1126 + 31095651-31096115 33 0.24 03_02_0765 + 11000724-11002496 33 0.24 03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655,904... 33 0.24 11_01_0066 - 536281-537196,537397-537452 33 0.32 08_01_0202 - 1638978-1639571 33 0.32 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 33 0.32 07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398,553... 33 0.32 06_01_0178 + 1386981-1387505 33 0.32 05_05_0173 + 22956927-22958615 33 0.32 04_04_1413 - 33386049-33386339 33 0.32 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 33 0.32 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 33 0.32 12_02_0756 + 22839673-22839870,22839961-22842194,22842280-228425... 33 0.43 12_02_0193 + 15242068-15242265,15242356-15244589,15244675-152449... 33 0.43 12_01_0927 + 9196230-9196427,9196499-9197190,9197317-9198351,919... 33 0.43 11_06_0069 + 19770182-19770379,19770470-19772703,19772789-197730... 33 0.43 11_04_0270 - 15590955-15591146,15591421-15591502,15591592-155917... 33 0.43 10_07_0154 + 13487971-13488168,13488259-13488483,13488592-134904... 33 0.43 10_01_0112 - 1386762-1386953,1387228-1387309,1387399-1387509,138... 33 0.43 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 33 0.43 09_04_0487 - 18014469-18014660,18014935-18015016,18015297-180155... 33 0.43 09_02_0349 - 7632140-7632234,7632348-7632449,7632864-7632962,763... 33 0.43 09_02_0131 - 4693828-4694019,4694107-4694199,4694294-4694375,469... 33 0.43 08_02_0796 - 21300251-21300373,21300846-21301721 33 0.43 08_02_0450 - 17266977-17267165,17268017-17268053,17268139-172695... 33 0.43 08_02_0194 + 14084828-14085025,14085116-14085788,14085855-140870... 33 0.43 08_01_0440 + 3875422-3875619,3875710-3876382,3876449-3877943,387... 33 0.43 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 33 0.43 06_03_1042 - 27089563-27089594,27090017-27090577,27090740-27090797 33 0.43 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 33 0.43 06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926,999... 33 0.43 06_01_1155 + 9777611-9777808,9777899-9780132,9780218-9780469,978... 33 0.43 06_01_0486 - 3455030-3455770 33 0.43 05_01_0577 + 5159934-5160131,5160222-5162455,5162541-5162792,516... 33 0.43 05_01_0571 - 5067558-5067749,5068024-5068105,5068195-5068305,506... 33 0.43 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 33 0.43 04_01_0365 - 4796780-4796971,4797246-4797327,4797417-4797527,479... 33 0.43 02_01_0374 - 2702804-2702995,2703270-2703351,2703441-2703551,270... 33 0.43 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 33 0.43 01_06_1321 + 36280691-36281269 33 0.43 01_06_0146 + 26969011-26969995,26970878-26970930 33 0.43 01_06_0075 - 26201231-26201422,26201697-26201778,26201868-262019... 33 0.43 01_05_0224 + 19485296-19485493,19485584-19487817,19487903-194881... 33 0.43 12_01_0841 - 7873458-7874225 32 0.56 12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 32 0.56 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 32 0.56 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 32 0.56 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 32 0.56 08_01_0531 - 4604556-4604582,4604829-4604921,4605381-4605572,460... 32 0.56 06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411... 32 0.56 06_02_0125 + 12122812-12122911,12123647-12123993 32 0.56 05_01_0380 + 2978256-2979284 32 0.56 03_06_0599 + 34984869-34985319,34986581-34987563 32 0.56 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 32 0.56 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 32 0.56 12_01_0319 + 2440129-2440661,2440875-2440902 27 0.63 07_03_0111 + 13535912-13535972,13536081-13536142,13536418-135365... 26 0.69 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 29 0.73 12_02_1219 + 27096477-27096590,27096704-27097078 32 0.74 09_06_0283 + 22024779-22026134,22026181-22026714 32 0.74 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 32 0.74 07_03_0329 + 16840051-16840917,16840999-16841342,16841444-168415... 32 0.74 06_03_0674 + 23422004-23422552,23423295-23423369,23424360-234244... 32 0.74 05_04_0303 - 20010761-20011756 32 0.74 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 32 0.74 04_04_0675 + 27183826-27184443 32 0.74 01_01_1044 + 8231933-8231941,8232091-8232166,8232423-8232871 32 0.74 06_03_0743 + 24069752-24070483,24071890-24072345 26 0.77 11_06_0610 - 25449085-25453284 31 0.98 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 31 0.98 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 31 0.98 10_08_0116 + 14935582-14936089,14936850-14937188,14937914-149379... 31 0.98 09_05_0008 + 20042390-20042845,20043323-20043457,20043539-200436... 31 0.98 09_03_0145 - 12749288-12751510 31 0.98 07_01_0516 - 3850252-3852870 31 0.98 06_03_1370 + 29645598-29646288,29646364-29646752 31 0.98 06_02_0127 + 12140843-12140966,12141170-12141567 31 0.98 04_03_0709 + 18902507-18902704,18902795-18905028,18905114-189053... 31 0.98 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 31 0.98 02_02_0100 - 6783821-6784339,6784815-6784984,6785062-6785164,678... 31 0.98 05_07_0031 - 27183252-27183317,27183542-27184282 31 1.0 12_02_1114 - 26171876-26172493 31 1.3 12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732... 31 1.3 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 31 1.3 10_07_0161 - 13674631-13675433,13675793-13675862 31 1.3 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 31 1.3 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 31 1.3 06_02_0126 + 12130409-12130532,12131015-12131373 31 1.3 03_05_0704 - 26953474-26953643,26953770-26953801,26953915-269540... 31 1.3 02_05_0149 + 26290236-26290880 31 1.3 02_03_0120 + 15463163-15465250 31 1.3 01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 31 1.3 01_06_0561 + 30251547-30252173,30252248-30252405,30253250-302541... 31 1.3 01_02_0007 + 10132380-10133201 31 1.3 01_01_1108 + 8758486-8758815,8758913-8758960,8761512-8761664,876... 31 1.3 01_01_0070 - 542603-542686,542803-543441 31 1.3 05_04_0011 + 17139322-17139451,17139552-17140174 26 1.3 12_01_1043 + 10731454-10732131 31 1.7 10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212... 31 1.7 10_08_0521 + 18500105-18500529,18501216-18501284,18501467-185015... 31 1.7 08_02_1615 + 28257275-28258428,28258523-28259144 31 1.7 08_02_0602 + 19183549-19184919 31 1.7 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 31 1.7 07_03_0594 - 19833967-19834557 31 1.7 07_01_0479 + 3606663-3607448 31 1.7 06_02_0122 - 12095385-12095713,12096018-12096120 31 1.7 05_06_0078 - 25412770-25413852 31 1.7 04_04_1687 - 35365766-35366356,35367137-35368135 31 1.7 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 31 1.7 03_05_0630 + 26260159-26260272,26260520-26260894 31 1.7 03_02_0738 - 10824121-10825572 31 1.7 02_03_0388 + 18429538-18430598,18430971-18431081,18431165-184312... 31 1.7 01_03_0005 + 11568545-11569119,11569179-11569191 31 1.7 10_08_0214 - 15915156-15915713 30 2.3 10_08_0213 - 15912048-15912716 30 2.3 10_08_0146 - 15184123-15184968,15185049-15185519,15185606-15185869 30 2.3 07_03_0154 + 14509979-14512033 30 2.3 07_03_0089 - 13300902-13301645 30 2.3 07_01_0862 - 7172083-7172931 30 2.3 06_03_1153 - 28047125-28047751 30 2.3 06_03_0696 + 23617687-23617851,23618838-23619536 30 2.3 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 30 2.3 04_04_1414 - 33394518-33394847 30 2.3 04_04_1070 + 30579263-30579861,30579970-30580095,30580190-30580394 30 2.3 03_06_0365 - 33399422-33399925,33400470-33400583,33400762-334009... 30 2.3 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 30 2.3 03_05_0843 + 28126480-28127007,28127092-28127457,28129388-281294... 30 2.3 03_05_0690 + 26778567-26778804,26778950-26779024,26779995-267800... 30 2.3 03_03_0106 - 14500935-14501263,14501357-14501432,14501531-14501542 30 2.3 03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714... 30 2.3 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 30 2.3 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 30 2.3 01_06_1596 - 38514278-38514346,38514547-38514705,38514776-385148... 30 2.3 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 30 2.3 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 30 2.3 02_01_0158 - 1103461-1104186 30 2.3 12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388,784... 29 3.0 12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409... 30 3.0 11_06_0016 - 19284810-19284926,19285527-19286879 30 3.0 11_01_0621 - 4981070-4981136,4982906-4983825 30 3.0 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 30 3.0 08_01_0134 + 1067826-1068158 30 3.0 07_03_1710 - 28903614-28903673,28904982-28905146,28905453-289056... 30 3.0 07_03_1136 + 24218601-24218734,24218769-24219906 30 3.0 07_03_0091 + 13312904-13313647 30 3.0 07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991,615... 30 3.0 06_01_1113 - 9164953-9165044,9166453-9166586,9166624-9166734,916... 30 3.0 06_01_0194 + 1503350-1503554,1504399-1504490,1504835-1504935,150... 30 3.0 05_06_0026 - 25024807-25025300,25025432-25025495,25025567-250256... 30 3.0 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 30 3.0 05_03_0040 - 7646525-7647775 30 3.0 05_03_0039 - 7621613-7622695 30 3.0 04_03_0904 + 20717005-20718087 30 3.0 04_03_0747 - 19251617-19251781,19252377-19252502,19252606-192527... 30 3.0 01_06_1758 - 39681942-39682030,39682115-39682345,39682643-396826... 30 3.0 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 30 3.0 01_06_1377 + 36764461-36765339 30 3.0 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 30 3.0 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 30 3.0 10_08_0221 - 15980370-15980927 28 3.0 10_08_0880 + 21267034-21267537 29 4.0 10_08_0217 - 15962192-15962884 29 4.0 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 29 4.0 09_04_0180 + 15367737-15367755,15368874-15369739 29 4.0 09_02_0601 + 11112201-11112386,11112471-11114080,11114345-111145... 29 4.0 08_02_1256 + 25645085-25645396 29 4.0 08_02_1084 - 24232968-24234779 29 4.0 08_02_0839 + 21693348-21694853 29 4.0 07_01_0037 + 301864-302349 29 4.0 06_01_0760 - 5676973-5677830 29 4.0 06_01_0690 + 5033943-5034740 29 4.0 05_01_0210 + 1583176-1584177 29 4.0 04_04_0592 + 26477974-26479311 29 4.0 04_02_0026 + 8708765-8710935,8711021-8711272,8711353-8711463,871... 29 4.0 04_01_0354 - 4646826-4647314 29 4.0 03_05_0252 - 22403504-22404676 29 4.0 03_02_0865 - 11895257-11895340,11896004-11896069,11896297-118963... 29 4.0 03_02_0342 - 7645323-7645909,7646323-7646491 29 4.0 02_04_0264 - 21393029-21393046,21394249-21394814,21395005-21395623 29 4.0 02_04_0140 - 20156655-20156834,20157139-20159345,20159970-20160042 29 4.0 02_03_0279 + 17250347-17252098 29 4.0 02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410,939... 29 4.0 02_01_0017 - 112766-113650 29 4.0 01_01_0445 - 3319451-3320035 29 4.0 01_01_0082 + 625198-625719 29 4.0 03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468,593... 25 4.5 12_01_0495 - 3935395-3937110 29 5.2 10_08_0236 + 16078162-16078731 29 5.2 10_02_0009 + 4128909-4130123 29 5.2 08_01_0060 - 413088-413999 29 5.2 07_03_0435 + 18182657-18183509,18184477-18184574,18184663-181848... 29 5.2 06_03_1121 + 27767707-27768065,27768612-27769034,27770013-277701... 29 5.2 05_01_0142 - 940421-940701,941262-941574 29 5.2 04_04_1628 + 34874688-34874915,34875182-34875232,34875532-348756... 29 5.2 04_04_1536 - 34207425-34207490,34207801-34208268,34208345-342084... 29 5.2 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 29 5.2 04_04_0176 - 23329589-23331043 29 5.2 02_05_1057 + 33809982-33810366,33810436-33810687,33810727-338109... 29 5.2 01_01_0046 - 331758-332627 29 5.2 09_02_0351 - 7686974-7686983,7687142-7687195,7687363-7687408,768... 24 6.3 11_03_0163 - 10970459-10970725 29 6.9 10_08_0242 - 16120554-16121129 29 6.9 10_08_0215 - 15939842-15940056,15940235-15940913 29 6.9 10_07_0107 - 12936839-12937030,12937305-12937386,12937476-129375... 29 6.9 10_03_0023 - 7151465-7152111,7152222-7152405 29 6.9 08_02_1019 - 23657175-23658047 29 6.9 07_03_0471 + 18501496-18502104,18503009-18503260,18503367-185035... 29 6.9 07_01_0753 - 5799733-5799741,5799938-5800642 29 6.9 06_03_1506 + 30641428-30642168 29 6.9 06_01_0586 - 4203024-4203425,4203527-4203595,4203681-4203746,420... 29 6.9 05_03_0662 + 16732965-16733037,16733310-16733413,16734468-167348... 29 6.9 05_01_0281 + 2186500-2187435,2187518-2187616,2187707-2187772,218... 29 6.9 04_04_1125 + 31085106-31085714 29 6.9 04_04_0760 - 27837170-27837328,27837441-27837504,27837812-278381... 29 6.9 04_04_0708 - 27441373-27442611 29 6.9 04_03_0212 + 12697854-12698549,12698655-12698930,12698991-126990... 29 6.9 03_06_0600 + 34988743-34989407,34990033-34990051 29 6.9 03_05_0267 - 22538631-22539452 29 6.9 03_03_0008 - 13674602-13674708,13675272-13675439,13676169-136767... 29 6.9 02_05_0405 + 28708077-28708391,28708478-28708573,28709030-287094... 29 6.9 02_04_0271 + 21445113-21445865,21446727-21446788,21446927-214470... 29 6.9 02_04_0021 + 18975992-18976408 29 6.9 02_02_0663 - 12740733-12741104,12741260-12741326,12741709-127418... 29 6.9 01_05_0292 + 20518668-20519090,20519213-20519281,20520204-205204... 29 6.9 01_02_0031 + 10364487-10365407 29 6.9 12_02_0408 + 18659494-18660362,18660472-18660634,18660976-186611... 24 7.8 04_04_0951 + 29614196-29615275 26 8.1 09_06_0149 - 21222976-21223065,21223460-21224173 24 8.3 12_02_1070 - 25814741-25815850 28 9.2 11_02_0086 + 8186355-8186667,8186773-8187335 28 9.2 10_08_0343 - 16960764-16960895,16961166-16961171,16961272-169616... 28 9.2 10_08_0222 - 15983756-15984313 28 9.2 10_08_0219 - 15972061-15972110,15972411-15972632,15972673-15972955 28 9.2 08_01_0546 - 4746118-4746580,4747335-4747342 28 9.2 07_03_0600 + 19866757-19867218,19867920-19868429 28 9.2 07_01_0466 - 3518315-3521428 28 9.2 06_03_1133 - 27886823-27887088,27887837-27888629,27888674-27889000 28 9.2 06_03_1006 + 26844161-26844198,26844304-26844372,26844526-268445... 28 9.2 06_02_0257 - 13533689-13533714,13533799-13533925,13534013-135341... 28 9.2 06_02_0120 + 12055076-12055175,12055322-12055725 28 9.2 05_02_0122 - 6840840-6841307 28 9.2 04_04_0662 - 27051508-27051828,27051878-27053438,27054333-27054733 28 9.2 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 28 9.2 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 28 9.2 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 28 9.2 03_02_0350 - 7734494-7734952,7735765-7736133 28 9.2 02_05_1277 - 35408097-35409080 28 9.2 02_05_0201 + 26687369-26689228 28 9.2 02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089,527... 28 9.2 02_01_0688 + 5131555-5132334 28 9.2 02_01_0016 + 110796-110979,111252-111768,111847-112213 28 9.2 01_01_0929 - 7344911-7345978 28 9.2 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 28 9.2 01_01_0796 + 6190931-6192745 28 9.2 02_01_0224 - 1461924-1462227,1462602-1462798,1463059-1463213,146... 24 9.8 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P P Sbjct: 426 PPPPLPPPPPPPPPPPPPLPPNMPPPLPPPPEP 458 Score = 37.1 bits (82), Expect = 0.020 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 425 PPPPPLPPPPPPPPPPPP---PLPPNMPPPLPP 454 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPPP 455 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 841 LXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 L PP P P P P PP P PP Sbjct: 424 LPPPPPLPPPPPPPPPPPPPLPPNMPPP 451 >08_01_0059 - 394001-394708 Length = 235 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 3 PPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPP 35 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 4 PPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPP 36 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP + PPP PP P PP P P Sbjct: 11 PPPPATPPPPPRRAPPPPSPPIRPPPPPTPRP 42 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 833 PPXSXXPPPP---XPPPXPXXXXXPPXXPXXXPP 925 PP + PPPP PPP P PP P P Sbjct: 12 PPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAP 45 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP P P P PP P PP Sbjct: 25 PPPPSPPIRPPPPPTPRP-YAPPPPSHPLAPPP 56 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 5/38 (13%) Frame = +2 Query: 827 PXPPXSXXPPP-----PXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP P PPP P PP PP Sbjct: 18 PPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPP 55 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP P P PP P PP Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPP 26 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP P P P P PP Sbjct: 37 PPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPP 69 >03_01_0515 - 3864796-3865425 Length = 209 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPX--SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 74 PPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPP 108 Score = 35.1 bits (77), Expect = 0.080 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P S PPPP PPP PP P P Sbjct: 93 PPPAASPPPPPPSPPPPSPVKSSPPPPPAWSP 124 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP P PP P PP Sbjct: 75 PPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPP 109 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP PP P P P P Sbjct: 92 PPPPAASPPPPPPSPPPPSPVKSSPPPPPAWSP 124 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP + P P PPP P PP P PP Sbjct: 62 PPPAAGPLMPPPPPPPSVTSSPPPPPLPPPP 92 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P PP P P Sbjct: 84 PPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSP 116 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP PPP PP P PP Sbjct: 62 PPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPP 94 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P L PP P PS P P PP P P PP Sbjct: 64 PAAGPLMPPPPPPPSVTSSP-PPPPLPPPPPPP 95 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP PP PP Sbjct: 40 PSPPTEASPPPLAPPPSVTSSPPPPAAGPLMPP 72 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP PPP P P P PP Sbjct: 73 PPPPPSVTSSPP-PPPLPPPPPPPAASPPPPPP 104 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P PP PP Sbjct: 53 PPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPP 85 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P P P P PP Sbjct: 91 PPPPPAASPPPPPPSP---PPPSPVKSSPPPPP 120 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPP 386 Score = 37.9 bits (84), Expect = 0.011 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 832 PXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P + PP P P P P P PP P P PP Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPPP PPP P PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPP 377 Score = 35.5 bits (78), Expect = 0.060 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP PP Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PP P PPP P PP P Sbjct: 362 PPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P P PP Sbjct: 358 PPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 >12_02_1174 - 26696869-26698191 Length = 440 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 146 PQPPPSLPPPPPPPPPPP-----PPRPPSVKPP 173 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P P P PP Sbjct: 150 PSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPP 182 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PPP P PP P P Sbjct: 142 PPVKPQPPPSLPPPPPPPPPPPPPRPPSVKP 172 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPP--PPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP PP PP P P P PP Sbjct: 179 PQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPP 213 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PP P PPP P P P Sbjct: 210 PQPPPTLPPPSPPPPPPTVPPRTPGDTPAVVEP 242 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PPP PP P P Sbjct: 116 PPALSPVPPPPPPPRTRTRVEPPHRPPPVKP 146 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P PPPP PPP P Sbjct: 288 PPEPTKPKPPPPSPPPPP 305 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 832 PXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P P P PP P P P Sbjct: 137 PPHRPPPVKPQPPPSLPPPPPPPPPPPPPRP 167 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP PP PP P PP Sbjct: 190 PPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPP 222 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S PPPP PP P PP Sbjct: 217 PPPSPPPPPPTVPPRTPGDTPAVVEPKPQPP 247 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P S PPPP PPP P PP P PP Sbjct: 613 PNRSVPPPPPPPPPLPNHSVLPPPPPPPPPP 643 Score = 35.5 bits (78), Expect = 0.060 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXP-PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P P + PPPP PPP P P P PP Sbjct: 535 PSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPP 568 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP---XXXXXPPXXPXXXPP 925 P P + PPPP PPP P PP P PP Sbjct: 537 PSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPP 572 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P P P PP Sbjct: 583 SQPPPPPPPPPLPNCLVPSPPPPPPPPP 610 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P S PPPP PPP P Sbjct: 626 PLPNHSVLPPPPPPPPPP 643 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP P PP P PP Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP P P P P PP Sbjct: 563 PPPPPPPPPPPPLPQSNYASSQPPPPPPPPP 593 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P P PP Sbjct: 582 SSQPPPPPPPPPLPNCLVPSPPPPPPPP 609 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P P Sbjct: 600 PSPP----PPPPPPPILPNRSVPPPPPPPPPLP 628 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PPP P PP PP Sbjct: 751 PPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPP 783 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +2 Query: 842 SXXPPPPXPPP-XPXXXXXPPXXPXXXPP 925 S PPPP PPP P P P PP Sbjct: 686 SKGPPPPPPPPLPPANRTNGPGVPSAPPP 714 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P P PP PPP P P PP Sbjct: 592 PPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPP 624 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP PPP P P PP Sbjct: 593 PLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPP 625 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXP 910 PPPP PP P PP P Sbjct: 637 PPPPPPPSLPNRLVPPPPAP 656 >07_01_0080 + 587674-588510 Length = 278 Score = 37.9 bits (84), Expect = 0.011 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP S PPPP PPP P PP Sbjct: 96 PPPPSSGSPPPPPPPPPPPPPPPPP 120 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P PS P P PP P P PP Sbjct: 94 PPPPPPSSGSPPPPPPPPPPPPPPP 118 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP S PPP PPP P PP Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPPPP 119 Score = 33.1 bits (72), Expect = 0.32 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 854 PPPXPPPXPXXXXXPPXXPXXXPP 925 PPP PPP P PP P PP Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPP 114 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP PP P PP Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPP 115 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P PP P P PP Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPP 116 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P PP P P PP Sbjct: 93 PPPPPPPSSGSPPPPPPPPPPPPPP 117 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P S P P PP P P PP Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPPPP 119 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP P P PP P PP Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP PP P PP Sbjct: 1926 PPPHAPPPPPPPPPVEGKPKPPPHAPPPPPP 1956 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP PP PP Sbjct: 1923 PKQPPPHAPPPPPPPPPVEGKPKPPPHAPPPPP 1955 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPP 379 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P P PP Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P PP Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP P P PP Sbjct: 342 PVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPP 374 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P PP P P P Sbjct: 352 PPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVP 384 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Frame = +1 Query: 853 PXPXP-SPXXXPXPXPPXXPXPXPP 924 P P P P P P PP P P PP Sbjct: 338 PSPRPVQPSNAPPPPPPPPPPPPPP 362 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P P PPP PPP P PP Sbjct: 340 PRPVQPSNAPPPPPPPPPPPPPPPP 364 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPP P P P PP P PP Sbjct: 35 PPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPP 67 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P P P P P P P Sbjct: 39 PAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGP 70 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P P P PP Sbjct: 15 PPRPTPAPQATPPPAIPESGPPPPP 39 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P+P P P P P P Sbjct: 37 PPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPP 68 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P P PP P P P PP P PP Sbjct: 5 PDPIQQDSPAPPRPTPAP-QATPPPAIPESGPP 36 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP-XPXXXXXPPXXPXXXPP 925 P PP P PPP P PP P PP Sbjct: 13 PAPPRPTPAPQATPPPAIPESGPPPPPAPDMPPP 46 >06_03_0790 - 24636805-24637770 Length = 321 Score = 36.3 bits (80), Expect = 0.035 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 126 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRG 122 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 125 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 127 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 128 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 101 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 105 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 107 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 108 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 109 GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 110 GGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 111 GGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 114 GGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 115 GGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 117 GGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNG 149 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 78 GVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 118 GGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGG 150 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGG 123 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGG 124 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 129 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 132 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGGG GG G Sbjct: 106 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 138 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG GG G Sbjct: 112 GGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG GG G Sbjct: 113 GGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG + G G Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNG 156 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG G G Sbjct: 122 GGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDG 153 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG + G Sbjct: 241 GWESSGGGGGRGDVSGAGGGGGGGGGDDANG 271 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GG + G G Sbjct: 127 GGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDG 159 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 36.3 bits (80), Expect = 0.035 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXP 910 PP + PPPP PPP P PP P Sbjct: 71 PPLAASPPPPPPPPPPRNSPSPPKPP 96 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PP PP PP Sbjct: 82 PPPPPRNSPSPPKPPSQAAQSPLPPTTTTTTPP 114 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 36.3 bits (80), Expect = 0.035 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCG 72 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 55 GGGGGGGGGGGGSGGGCGGGGGGGGGSSGGG 85 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG GG G Sbjct: 45 GGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGG 77 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GG G GG G Sbjct: 44 GGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGG 76 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 47 GGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGG 79 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG GG G Sbjct: 43 GGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGG 75 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GGG GGG GG G Sbjct: 46 GGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGG 78 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG G G Sbjct: 52 GGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSG 83 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG GGG GGGG GG Sbjct: 56 GGGGGGGGGGGSGGGCGGGGGGGGGSSGGGG 86 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXE 841 GG G GG G GGG GGG E Sbjct: 61 GGGGGGSGGGCGGGGGGGGGSSGGGGSE 88 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 36.3 bits (80), Expect = 0.035 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 69 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 68 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 70 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 71 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 44 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 76 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 48 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 80 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 50 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 82 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 51 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 83 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 52 GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 84 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 53 GGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 85 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 54 GGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 86 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 57 GGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 58 GGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 60 GGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 32 GCGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 63 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRG 65 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGG 66 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGG 67 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 72 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 75 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGGG GG G Sbjct: 49 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 81 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG GG G Sbjct: 55 GGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG GG G Sbjct: 56 GGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GGG GGGG GG G Sbjct: 59 GGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 >07_03_0560 + 19479597-19480667 Length = 356 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG E GG G Sbjct: 94 GGGGGLGGGGGKGGGFGGGVGGGGGGEGGGLG 125 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 230 GGMGGGAGGGGGLGGGGGGGMGGGGGGGMGG 260 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG GG G Sbjct: 71 GGFGGGGGGGLGGGGGFGGGGGAGGGGGLGGGG 103 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGGG GG G Sbjct: 74 GGGGGGGLGGGGGFGGGGGAGGGGGLGGGGGKG 106 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 147 GGGFGAGGGVGGGSGTGGGLGGGGGGGFGGDG 178 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 183 GGGGGKEGGFGAGGGVGGGAGGGGGMGGGGGG 214 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG + GG G Sbjct: 195 GGGVGGGAGGGGGMGGGGGGGFGGGGGKGGGFG 227 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 217 GGGGGKGGGFGAGGGMGGGAGGGGGLGGGGGG 248 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 223 GGGFGAGGGMGGGAGGGGGLGGGGGGGMGGGG 254 Score = 32.3 bits (70), Expect = 0.56 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXG-GGGXXEXGGXG 826 GG G GG G GGG G GGG + GG G Sbjct: 77 GGGGLGGGGGFGGGGGAGGGGGLGGGGGKGGGFG 110 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 89 GGGGAGGGGGLGGGGGKGGGFGGGVGGGGGGEG 121 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG GG G Sbjct: 193 GAGGGVGGGAGGGGGMGGGGGGGFGGGG 220 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG GG Sbjct: 68 GGDGGFGGGGGGGLGGGGGFGGGGGAGGGG 97 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 114 GGGGGGEGGGLGG--GGGGGLGGGGGGGVGGGG 144 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 238 GGGGLGGGGGGGMGGGGGGGMGGGAGGGFGG 268 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG + GG G Sbjct: 121 GGGLGGGGGGGLGGGGGGGVGGGG-GQGGGFG 151 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG G G Sbjct: 206 GGMGGGGGGGFGGGGGKGGGFGAGGGMGGGAGG 238 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G G G GG G GG G Sbjct: 256 GGMGGGAGGGFGGGAGGGAGQGGSGGLGGGGGG 288 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG E GG G Sbjct: 163 GGGLGGGGGGGFGGDG-GGGLGGGGGKE-GGFG 193 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGG--GGXXEXGGXG 826 GG G GG G GGG GG GG GG G Sbjct: 178 GGGGLGGGGGKEGGFGAGGGVGGGAGGGGGMGGGG 212 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGG--GGXXEXGGXG 826 GG G GG G GGG GG GG GG G Sbjct: 212 GGGGFGGGGGKGGGFGAGGGMGGGAGGGGGLGGGG 246 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGG--XGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 229 GGGMGGGAGGGGGLGGGGGGGMGGGGGGGMGGGAG 263 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGG--GGXXEXGGXG 826 GG G GG G GGG GG GG GG G Sbjct: 246 GGGGMGGGGGGGMGGGAGGGFGGGAGGGAGQGGSG 280 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGG--GXGGGGXXEXGGXG 826 GG G GG G GG G GGGG GG G Sbjct: 260 GGAGGGFGGGAGGGAGQGGSGGLGGGGGGGLGGGG 294 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXG---GGGXXEXGGXG 826 GG G GG G GGG G GGG GG G Sbjct: 280 GGLGGGGGGGLGGGGGAGGGLGGGAGGGLGHGGGLG 315 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 100 GGGGGKGGGFGGGVGGGGGGEGGGLGGGGGGG 131 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG GG G Sbjct: 85 GGFGGGGGAGGGGGLGGGGGKGGGFGGGVGGGG 117 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG GG G Sbjct: 130 GGLGGGGGGGVGGGGGQGGGFGAGGGV-GGGSG 161 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 136 GGGGVGGGGGQGGGFGAGGGVGGGS-GTGGGLG 167 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 294 GGAGGGLGGGAGGGLGHGGGL-GGGLGHGGGLG 325 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG G G Sbjct: 305 GGGLGHGGGLGGGLGHGGGLGGGGFGVGVGVG 336 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 58 GRCRGGGGGFGGDGGFGGG-GGGGLGGGGGFG 88 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 63 GGGGFGGDGGFGG--GGGGGLGGGGGFGGGG 91 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 126 GGGGGGLGGGGGGGVGGGGGQGGG-FGAGGGVG 157 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGG + GG Sbjct: 151 GAGGGVGGGSGTGGGLGGGGGGGFGGDGGG 180 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 193 GAGGGVGGGAGGGGGMGGG-GGGGFGGGGGKG 223 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 227 GAGGGMGGGAGGGGGLGGG-GGGGMGGGGGGG 257 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G GG G Sbjct: 277 GGSGGLGGGGGGGLGGGGGAGGGLGGGAGGGLG 309 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXX-----EXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 196 GGVGGGAGGGGGMGGGGGGGFGGGGGKGGGFGAGGGMG 233 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG GG G Sbjct: 255 GGGMGGGAGG-GFGGGAGGGAGQGGSGGLGGGG 286 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P P P P PP P P PP Sbjct: 317 PPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +1 Query: 745 PXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P PP P P P P P P P PP Sbjct: 311 PAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPP 370 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP + PPPP PP P PP Sbjct: 345 PPPPPAKGPPPPPPPKGPSPPPPPP 369 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PPP P PP P PP Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPP 345 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 827 PXPPXSXXPPPPX-PPPXPXXXXXPPXXPXXXP 922 P P + PPPP PPP P PP P P Sbjct: 330 PPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGP 362 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +2 Query: 827 PXPPXSXXPPPP---XPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 338 PPPPKGPPPPPPAKGPPPPPPPKGPSPPPPP 368 Score = 31.5 bits (68), Expect = 0.98 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPP PPP PP P Sbjct: 355 PPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP P PP PPP PP P Sbjct: 354 PPPPPPKGPSPPPPPPPGGKKGGPPPPP 381 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PP PP P PP Sbjct: 310 SPAPPPPPPPKPAAAAPPPPPPPKAAPP 337 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P PP PP Sbjct: 346 PPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPP 378 >09_04_0506 - 18188785-18190599 Length = 604 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 306 GGNYGGGRGGGGGGPGGGGGGGGGGNWGRGGGG 338 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGGG GG G Sbjct: 293 GGGAAGGPGGAQVGGNYGGGRGGGGGGPGGGGG 325 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 854 PPPXPPPXPXXXXXPPXXPXXXPP 925 PPP PPP P PP PP Sbjct: 50 PPPQPPPPPQQQQQPPPISQQPPP 73 >07_03_0558 + 19461369-19462448 Length = 359 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 111 GGQGGGFGGGAGAGGGAGGGLGGGGGFGGGGGG 143 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 253 GGHGGGFGGGAGVGSGAGGGVGGGGGFGGGGGG 285 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 289 GGHGSGFGGGAGVGGGAGGGVGGGGGFGGGGGG 321 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 185 GGHGGGFGGGAGVGGGAGGGVGGGGGFGGGG 215 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 67 GGGGGGLGGGHGGGFGGGGGLGGGASGGVGGGG 99 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGGG GG G Sbjct: 75 GGHGGGFGGGGGLGGGASGGVGGGGGFGGGGGG 107 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 118 GGGAGAGGGAGGGLGGGGGFGGGGGGGLGGGG 149 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 141 GGGGLGGGGGHGGGFGAGGGVGGGAGGGVGGGG 173 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG GG G Sbjct: 149 GGHGGGFGAGGGVGGGAGGGVGGGGGFGGGGGG 181 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 218 GLGGGQGGGFGAGGGAGGGIGGGGGFGGGGGG 249 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG GG G Sbjct: 325 GGHGGGFGAGAGVGGGAGGGVGGGGGFGGGGGG 357 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 47 GEGEGFGGGGGFGGGGGGGLGGGGGGLGGGHG 78 Score = 32.7 bits (71), Expect = 0.43 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 GG G GG G GGG GGG G + GG G Sbjct: 85 GGLGGGASGGVGGGGGFGGGGGGGLGGGQGGGFG 118 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 124 GGGAGGGLGGGGGFGGGGGGGLGGGGGHGGGFG 156 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 GG G GG G GGG GGG G GG G Sbjct: 159 GGVGGGAGGGVGGGGGFGGGGGGGLGGGHGGGFG 192 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG GG Sbjct: 82 GGGGGLGGGASGGVGGGGGFGGGGGGGLGG 111 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG GG Sbjct: 156 GAGGGVGGGAGGGVGGGGGFGGGGGGGLGG 185 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG GG Sbjct: 192 GGGAGVGGGAGGGVGGGGGFGGGGGSGLGG 221 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG GG Sbjct: 224 GGGFGAGGGAGGGIGGGGGFGGGGGGGLGG 253 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG GG Sbjct: 296 GGGAGVGGGAGGGVGGGGGFGGGGGGGLGG 325 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 GG G GG G GGG GGG G GG G Sbjct: 89 GGASGGVGGGGGFGGGGGGGLGGGQGGGFGGGAG 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 97 GGGGFGGGGGGGLGGGQGGGFGGGAGAGGGAGG 129 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G G G GGG GG G Sbjct: 103 GGGGGGLGGGQGGGFGGGAGAGGGAGGGLGGGG 135 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG G G Sbjct: 135 GGFGGGGGGGLGGGGGHGGGFGAGGGVGGGAGG 167 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 GG G GG G GGG GGG G GG G Sbjct: 163 GGAGGGVGGGGGFGGGGGGGLGGGHGGGFGGGAG 196 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 171 GGGGFGGGGGGGLGGGHGGGFGGGAGVGGGAGG 203 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G G G GGG GG G Sbjct: 177 GGGGGGLGGGHGGGFGGGAGVGGGAGGGVGGGG 209 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 GG G GG G GGG GGG G GG G Sbjct: 231 GGAGGGIGGGGGFGGGGGGGLGGGHGGGFGGGAG 264 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 239 GGGGFGGGGGGGLGGGHGGGFGGGAGVGSGAGG 271 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G G G GGG GG G Sbjct: 281 GGGGGGLGGGHGSGFGGGAGVGGGAGGGVGGGG 313 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G G G GGG GG G Sbjct: 317 GGGGGGLGGGHGGGFGAGAGVGGGAGGGVGGGG 349 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG GG G Sbjct: 39 GRCHGGGFGEGEGFGGGGGFGGGGGGGLGGGG 70 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG GG G Sbjct: 207 GGGGFGGGGGSGLGGGQGGGFGAGG-GAGGGIG 238 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G GG G Sbjct: 228 GAGGGAGGGIGGGGGFGGGGGGGLGGGHGGGFG 260 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G GG G Sbjct: 300 GVGGGAGGGVGGGGGFGGGGGGGLGGGHGGGFG 332 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 62 GGGGLGGGGGGLGG-GHGGGFGGGGGLGGGASG 93 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 107 GGLGGGQGGGFGGGAGAGGG-AGGGLGGGGGFG 138 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGG GG G Sbjct: 184 GGGHGGGFGGGAGVGGGAGGGVGGGGGFGGGGG 216 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 213 GGGGSGLGGGQGGGFGAGGG-AGGGIGGGGGFG 244 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GGG GGG GG G Sbjct: 53 GGGGGFGGGGGGGLGGGGGGLGGGHGGGFGGGG 85 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGG GG G Sbjct: 110 GGGQGGGFGGGAGAGGGAGGGLGGGGGFGGGGG 142 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G G G GGG GGGG GG Sbjct: 260 GGGAGVGSGAGGGVGGGGGFGGGGGGGLGG 289 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G G G G G GG G Sbjct: 245 GGGGGGLGGGHGGGFGGGAGVGSGAGGGVGGGG 277 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G GG G Sbjct: 268 GAGGGVGGGGGFGGGGGGGLGGGHGSGFGGGAG 300 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G G G GGG G G Sbjct: 275 GGGGFGGGGGGGLGGGHGSGFGGGAGVGGGAGG 307 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G G G G Sbjct: 311 GGGGFGGGGGGGLGGGHGGGFGAGAGVGGGAGG 343 >07_03_0177 - 14770777-14772045 Length = 422 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 65 GGFGGGGGGGGGGGFGGGGGFGGGGGGGLGGGG 97 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 73 GGGGGGFGGGGGFGGGGGGGLGGGGGGGLGGGG 105 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 81 GGGGFGGGGGGGLGGGGGGGLGGGGGFGKGG 111 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 52 GLGAGLGGGYGKGGGFGGGGGGGGGGGFGGGG 83 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 342 GGGFGKGGGIGGGFGKGGGLGGGGGLGGGGGG 373 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 352 GGGFGKGGGLGGGGGLGGGGGGGGGGFGGGGG 383 Score = 32.3 bits (70), Expect = 0.56 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXG-GGGXXEXGGXG 826 GG G GG G GGG G GGG + GG G Sbjct: 364 GGGLGGGGGGGGGGFGGGGGSGIGGGFGKGGGFG 397 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG GG G Sbjct: 59 GGYGKGGGFGGGGGGGGGGGFGGGGGFGGGGGG 91 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 69 GGGGGGGGGGFGGGGGFGGG-GGGGLGGGGGGG 100 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG GG G Sbjct: 353 GGFGKGGGLGGGGGLGGGGGGGGGGFGGGGGSG 385 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG GG Sbjct: 208 GGGIGKGGGLGGGFGKGGGLGGGGGLGGGG 237 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG GG Sbjct: 284 GGGIGKGGGIGGGFGKGGGLGGGGGLGGGG 313 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG GG G Sbjct: 54 GAGLGGGYGKGGGFGGGGGGGGGGGFGGGGGFG 86 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG + GG G Sbjct: 197 GGGGLGGGGGLGGGIGKGGGL-GGGFGKGGGLG 228 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG + GG G Sbjct: 229 GGGGLGGGGGLGGGIGKGGGL-GGGIGKGGGLG 260 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG G G Sbjct: 250 GGGIGKGGGLGGGFGKGGGLGGGGGLGGGEDG 281 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG + GG G Sbjct: 273 GGLGGGEDGGLGGGIGKGGGI-GGGFGKGGGLG 304 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXG-GGGXXEXGGXG 826 G G GG G GGG G GGG + GG G Sbjct: 300 GGGLGGGGGLGGGGGLGGGSGLGGGIGKGGGLG 332 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG GG G Sbjct: 348 GGGIGGGFGKGGGLGGGGGLGGGGGGGGGGFG 379 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G G G GGG GGGG GG Sbjct: 358 GGGLGGGGGLGGGGGGGGGGFGGGGGSGIGG 388 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G GG G Sbjct: 120 GGGFGKGGGFGGGFGKGGGIGGGIGHGAGGGFG 152 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 387 GGGFGKGGGFGFGVG-GGGFGGGGGGGGGGGG 417 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GG GGGG GG Sbjct: 176 GGGIGKGGGLGGGFGKSGGLGGGGGLGGGG 205 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG 853 GG G GG G GGG GGG Sbjct: 394 GGFGFGVGGGGFGGGGGGGGGGGG 417 >07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089, 4287286-4287350,4288346-4288451,4288529-4288750, 4289619-4289852,4289948-4290037,4290605-4291507 Length = 650 Score = 35.5 bits (78), Expect = 0.060 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP P P P PP Sbjct: 47 PAPRHAATPPPPPPPPTPAVEPTLPIPPASTPP 79 >06_03_1326 - 29355467-29355817 Length = 116 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 9 GGGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGG 41 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG GG G Sbjct: 7 GGGGGGKGGGGGGGGGKGGGGGSGGGGRSGGGG 39 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXG--GGXGGGGXXEXGGXG 826 GG G GG G G GG GGGG + GG G Sbjct: 16 GGGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEG 50 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 2 GGKGGGGGGGGKGGGGGGGGGKGGGGGSGGG 32 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG GG Sbjct: 3 GKGGGGGGGGKGGGGGGGGGKGGGGGSGGGG 33 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGG GG G Sbjct: 10 GGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGG 42 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG GG G Sbjct: 21 GGKGGGGGSGGGGRSGGGGGGGGGKGGGEGGSG 53 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG GGG GGGG GG G Sbjct: 3 GKGGGGGGGGKGGGGGGGGGKGGGGGSG 30 >03_01_0023 + 198414-198968 Length = 184 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 42 GGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSG 74 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 48 GGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGG 80 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGGG GG G Sbjct: 66 GGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGGG 98 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG G GG GG Sbjct: 46 GGGGGGRGGGGGSGGGSGGGGGSGGGGSGGG 76 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG G GG GG G Sbjct: 56 GGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGG 88 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GG GGGG GG G Sbjct: 64 GGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGG 96 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG G GG GG Sbjct: 36 GGGGGGGGGGGGGGGGRGGGGGSGGGSGGGG 66 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 38 GGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGG 70 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G G G G GG GG G Sbjct: 40 GGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGG 72 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GG G GG G Sbjct: 45 GGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGG 77 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 53 GGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSG 84 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G G G GG G GG G Sbjct: 55 GGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGG 87 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG GGG GGGG GG G Sbjct: 59 GGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGG 90 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG GGG GGGG GG G Sbjct: 63 GGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGG 95 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G G G GGGG GG G Sbjct: 65 GGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGG 97 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 59 GGGSGG--GGGSGGGGSGGGGSGGGGSGGGGGG 89 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G GGG GGGG GG G Sbjct: 26 GCQCGSCPSPGGGGGGGGGGGGGGGGRG 53 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G G G GG G GG G Sbjct: 50 GGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGG 82 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G G G GG G GG G Sbjct: 60 GGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSG 92 >01_01_0570 - 4231100-4232560 Length = 486 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 162 GGGGIGAGGGFGGGAGAGGGVGGGGRFGGGGMG 194 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GG G GG G Sbjct: 77 GGTGGGAAGGLGGGGGGGGGLGGSGGLGGGGMG 109 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG G GG GG Sbjct: 116 GGGGGGVGGGVGAGFGSGGGVGAGGGLRGGG 146 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG GG G Sbjct: 192 GMGGGGGFGGGAGGGVGGGGELGGGGMG 219 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 73 GGVGGGTGGGAAGGLGGGGG-GGGGLGGSGGLG 104 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 257 GGGAGGGMGGDIGG-GAGGGVGGGGGGGMGGGG 288 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 60 GVGGGEGGGVGVGGGVGGGTGGGAAGGLGGGG 91 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 GG G GG G GGG GGGG Sbjct: 270 GGAGGGVGGGGGGGMGGGGGFGGGG 294 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGG--GXGGGGXXEXGGXG 826 GG G GG G GG G GGGG GG G Sbjct: 81 GGAAGGLGGGGGGGGGLGGSGGLGGGGMGGSGGFG 115 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G G G GGG GGGG GG Sbjct: 140 GGLRGGGGVGAGGGGGFGGGAGGGGGIGAGG 170 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG GG G Sbjct: 146 GGVGAGGGGGFGGGAGGGGGIGAGGGF-GGGAG 177 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 265 GGDIGGGAGGGVGGGG-GGGMGGGGGFGGGG 294 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G GG G Sbjct: 56 GGGVGVGGGEGGGVGVGGGVGGGTGGGAAGGLG 88 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G E G G Sbjct: 377 GGGLGGGGGIGGGLGVGGGTGGGSGANEGAGMG 409 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 101 GGLGGGGMGGSGGFGGGGGGGVGGGVGAGFGSG 133 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG G GG GG Sbjct: 157 GGGAGGGGGIGAGGGFGGGAGAGGGVGGGG 186 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGG GG Sbjct: 229 GGGFGAGGGVGGGIGVGGGMGGGASGGIGG 258 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXG-GGGXXEXGGXG 826 G G GG G GGG G GGG GG G Sbjct: 365 GGGFGTGGGSGFGGGLGGGGGIGGGLGVGGGTG 397 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGG GG G Sbjct: 197 GGFGGGAGGGVGGGGELGGGGMGGGSGFGGGAG 229 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 65 GGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGG 97 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 79 GGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGG 110 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 51 GRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGGG 83 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 86 GGGGRGGGGGGGYGGGGGGGRGGGGGGGGRGGG 118 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 64 GGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGG 96 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 74 GGGGYGGGGGGYGGGGRGGG-GGGGYGGGGGGG 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 GG G GG G GGG GGGG Sbjct: 95 GGGYGGGGGGGRGGGGGGGGRGGGG 119 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GGG GGGG GG G Sbjct: 44 GGGGGGRGRGGGGGGGGGYGGGGVG 68 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 46 GGGGRGRGGGGGGGGGYGGGGVGGGYGGGGG 76 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G G G GGG GGGG GG Sbjct: 58 GGGGYGGGGVGGGYGGGGGGYGGGGGGYGGG 88 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG GG G Sbjct: 82 GGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGGG 114 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 94 GGGGYGGGGGGGRGGGGGGGGRGGGGRGGGRDG 126 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 Query: 897 GXXXXXGXGGGXGGGGXXEXGGXG 826 G G GGG GGGG + GG G Sbjct: 193 GAPSPAGGGGGGGGGGYNKSGGGG 216 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GGG GGG GG G Sbjct: 57 GGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGG 89 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 91 GGGGGGGYGGGGGG-GRGGGGGGGGRGGGGRGG 122 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 GG GG G GGG GGGG Sbjct: 230 GGGGYNRGGGDYNSGGRGGGTGGGG 254 >03_05_0576 + 25765137-25766420 Length = 427 Score = 35.1 bits (77), Expect = 0.080 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P S PPPP PPP PP P P Sbjct: 80 PPQPSSPPPPPPSPPPAAAVSVSPPTQPRPRP 111 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXP--PXXPXPXPP 924 PP P PSP P P P P P P PP Sbjct: 68 PPSPSPSPSPSPPPQPSSPPPPPPSPP 94 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXP 910 P P S P P P PPP P PP P Sbjct: 65 PEAPPSPSPSPSPSPPPQPSSPPPPPPSP 93 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 853 PXPXPSPXXXPXPXPPXXPXPXP 921 P P PSP P PP P P P Sbjct: 73 PSPSPSPPPQPSSPPPPPPSPPP 95 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PXPXPSPXXXPXPXPPXXPXPXPP 924 P PSP P P PP P PP Sbjct: 65 PEAPPSPSPSPSPSPPPQPSSPPP 88 >01_05_0490 + 22672241-22674679 Length = 812 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP S PPP PPP P Sbjct: 688 PLPPPSPPLPPPPPPPPP 705 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXP 880 PP PPPP PPP P Sbjct: 691 PPSPPLPPPPPPPPPP 706 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPPP PP PP Sbjct: 692 PSPPLPPPPPPPPPPMSEGEEEAPP 716 Score = 28.7 bits (61), Expect = 6.9 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P PP P P P PP P P P Sbjct: 608 PPPPPPPPSSIFYNLFKKGGSKSRRIHSVAPPQPPPPPPPTTRRSRKP-PQPPSRPAPPP 666 Query: 922 P 924 P Sbjct: 667 P 667 Score = 27.1 bits (57), Expect(2) = 0.089 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP 871 P PP PPPP PP Sbjct: 601 PAPPRRPPPPPPPPP 615 Score = 27.1 bits (57), Expect(2) = 1.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP 871 P PP PPPP PP Sbjct: 656 PQPPSRPAPPPPPPP 670 Score = 26.6 bits (56), Expect(2) = 0.089 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 854 PPPXPPPXPXXXXXPPXXPXXXPP 925 PPP PPP PP P P Sbjct: 641 PPPPPPPTTRRSRKPPQPPSRPAP 664 Score = 22.2 bits (45), Expect(2) = 1.6 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPP 901 P PP PP P PP Sbjct: 688 PLPPPSPPLPPPPPPPP 704 >12_01_0838 - 7830944-7831444 Length = 166 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG + GG G Sbjct: 123 GGSGQGSGSGYGYGYGKGGGGGGGGGGDGGGGG 155 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG GG G Sbjct: 47 GGNGSGSGSGYGYNYGKGGGQSGGGQGSGGGGG 79 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG GG G Sbjct: 95 GYGYGQGNGGAQGQGSGGGGGGGGGGGGGGSG 126 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG GG G Sbjct: 126 GQGSGSGYGYGYGKGGGGGGGGGGDGGGGGGG 157 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG G G Sbjct: 62 GKGGGQSGGGQGSGGGGGGGGGGSNGSGSGSG 93 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG G G Sbjct: 97 GYGQGNGGAQGQGSGGGGGGGGGGGGGGSGQG 128 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P P P PP Sbjct: 2 PPPPPPPPPPPPSPPRLPLTAHRLPLPPATSPP 34 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 827 PXPPX----SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P P Sbjct: 95 PPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQP 131 Score = 32.7 bits (71), Expect = 0.43 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 1/62 (1%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPS-PXXXPXPXPPXXPXPX 918 PP P PP P P PP P P P PP P P Sbjct: 56 PPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPS 115 Query: 919 PP 924 PP Sbjct: 116 PP 117 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPP PPP PP P P Sbjct: 83 PPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPP 114 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPP PPP P PP Sbjct: 108 PPPPPPPSPPPSAPPPPPPPPTQPP 132 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PP P PP P PP Sbjct: 108 PPPPPPPSPPPSAPPPPPPPPTQPP 132 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP PPP P PP PP Sbjct: 109 PPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPP 141 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P P PPP P P PP Sbjct: 110 PPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPP 142 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP P P PP P PP Sbjct: 33 PQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPP 65 >07_03_0559 + 19475893-19476783 Length = 296 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG E GG G Sbjct: 75 GGGGGGLGGGGGFGGGGGGGLGGGG-CEGGGFG 106 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 62 GGGGGFGGGGGFRGGGGGGLGGGGGFGGGGGG 93 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 68 GGGGGFRGGGGGGLGGGGGFGGGGGGGLGGGG 99 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 142 GGGFGAGGGVGGGSGTGGGLGGGGGGGFGGGG 173 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG GG G Sbjct: 149 GGVGGGSGTGGGLGGGGGGGFGGGGGGGIGGGG 181 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 GG G GG G GGG GGG G GG G Sbjct: 103 GGFGGGVGGGSGAGGGLGGGGGGGFGGGSGGGVG 136 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG GG G Sbjct: 107 GGVGGGSGAGGGLGGGGGGGFGGGSGGGVGGGG 139 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG + GG G Sbjct: 116 GGGLGGGGGGGFGGGSGGGVGGGG-GQGGGFG 146 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GG GGGG GG G Sbjct: 178 GGGGGKGGGFGAGGGVGGAAGGGGGMGSGGGG 209 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG G GG GG G Sbjct: 184 GGGFGAGGGVGGAAGGGGGMGSGGGGGFGGGG 215 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGG + GG G Sbjct: 190 GGGVGGAAGGGGGMGSGGGGGFGGGGGKGGGFG 222 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG G G Sbjct: 201 GGMGSGGGGGFGGGGGKGGGFGAGGVMGGGAGG 233 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG + GG G Sbjct: 158 GGGLGGGGGGGFGGGGGGGIGGGG-GKGGGFG 188 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG G GG GG G Sbjct: 93 GGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGGG 125 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 89 GGGGGGLGGGGCEGGGFGGGVGGGS-GAGGGLG 120 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG GG G Sbjct: 125 GGFGGGSGGGVGGGGGQGGGFGAGGGV-GGGSG 156 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG GGG GGGG GG G Sbjct: 212 GGGGGKGGGFGAGGVMGGGAGGGGGLGGGGGG 243 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -2 Query: 924 GGXXXG-XXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 98 GGCEGGGFGGGVGGGSGAGGGLGGGGGGGFGG 129 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 121 GGGGGGFGGGSGGGVGGGGGQGGG-FGAGGGVG 152 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 146 GAGGGVGGGSGTGGGLGGG-GGGGFGGGGGGG 176 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 163 GGGGGGFGGGGGGGIGGGGGKGGG-FGAGGGVG 194 >08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384, 7484473-7484603,7484726-7484802,7484981-7485064, 7487885-7488066,7488189-7488266,7489813-7489945, 7491610-7491670,7491861-7491942,7492143-7492271, 7492510-7492653,7493102-7493204,7493382-7493513, 7494127-7494485,7495149-7495229,7495384-7495450, 7495636-7495706,7496087-7496178,7496365-7496458, 7497692-7497789,7498206-7498341,7498599-7498618, 7498781-7498876,7498973-7499060,7499171-7499288, 7499738-7499759,7500203-7500326,7500625-7500702, 7500837-7500955,7501816-7501869,7502260-7502362, 7503133-7503261,7503345-7503453,7503788-7503819 Length = 1424 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP + PPP P P P PP P P Sbjct: 59 PSPPKASPTPPPQPQPHPQLQPPPPPAPLPPP 90 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P PP P P PP Sbjct: 66 PTPPPQPQPHPQLQPPPPPAPLPP 89 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP-PXPXXXXXP--PXXPXXXPP 925 P P PPPP PP P P P P P PP Sbjct: 155 PPLPLPPPPPPPMPPIPLPHMPFLPMMPHVPVPMPP 190 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +1 Query: 832 PXXLXXPPXPXPSPXXXP-XPXPPXXPXPXPP 924 P PP P PSP P P PP P P PP Sbjct: 32 PFRRPSPPPPPPSPVPSPAPPPPPHRPSPSPP 63 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP S P P PPP PP P Sbjct: 39 PPPPPSPVPSPAPPPPPHRPSPSPPPNP 66 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP P PP P P Sbjct: 36 PSPPPPPPSPVPSPAPPPPPHRPSP 60 >04_04_1582 - 34590698-34591199,34593849-34594690 Length = 447 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 GG G GG G GGG GGGG E G Sbjct: 231 GGVEEGSAGGGKKGGGGGGGGGGGGHGEKG 260 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 29.9 bits (64), Expect(2) = 0.20 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXP 880 PP PPPP PPP P Sbjct: 276 PPPPAGPPPPAPPPLP 291 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PP P P P PP Sbjct: 349 PPPPPPPAAPAAPRPPGPGPGPPPP 373 Score = 22.6 bits (46), Expect(2) = 0.20 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +2 Query: 857 PPXPPPXPXXXXXPPXXP 910 PP PP P PP P Sbjct: 321 PPPPPAHPAAPAPPPPAP 338 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 312 PLPSFYPSPPPPPPPPPP----PPPSFPWPFPP 340 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP PP P P Sbjct: 318 PSPPPP--PPPPPPPPPSFPWPFPPLAPLFPP 347 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P P P P P P P PP P P P Sbjct: 272 PPAFPFPHLPPIFSPPSPPPPPPPAFPFPFPQLPPLPHFP-PLPSFYPSPPPPPPPPPPP 330 Query: 922 P 924 P Sbjct: 331 P 331 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP P P PP P PP Sbjct: 263 PLPPWPWAPPPAFPFPHLPPIFSPPSPPPPPPP 295 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P P PP Sbjct: 320 PPPPPPPPPPPPPSFPWPFPPLAPLFPPYPSPP 352 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P L P P P P P PP P P PP Sbjct: 235 PPPPFLPFPLPPIPF-LTPPSPPPPAFPFPLPP 266 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP P PP P PP Sbjct: 300 PFPQLPPLPHFPPLPSFYPSPPPPPPPPPP 329 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P SP P P PP P PP Sbjct: 1162 PSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPP 1194 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP----XPXXXXXPPXXPXXXPP 925 P PP S PPP PPP P PP P PP Sbjct: 1171 PPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPP 1207 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP P P PPP P PP P P Sbjct: 1169 PPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPP 1200 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPP P P P PP P P Sbjct: 1183 PPPPPLPSGPPPQPAPPPLPIQPPPIPPPPVP 1214 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+ P P P P P PP Sbjct: 1161 PPSPPPATPPPPPPLSPSLPPPPPP 1185 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P SP P P PP P PP Sbjct: 1139 PPPLPEGPPPLPSDSPPCQP-PLPPSPPPATPP 1170 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP PPP PPP P P P P Sbjct: 1158 PPLPPSPPPATPPPPPPLSPSLPPPPPPPP 1187 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP P PP P PP Sbjct: 1124 PLPDGPPPLPLDAPPPPPLPEGPPP 1148 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P PP P PP Sbjct: 1158 PPLPPSPPPATPPPPPPLSPSLPPP 1182 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP P P PPP P P P PP Sbjct: 1181 PPPPPPPLPSGPPPQPAPPPLPIQPPPIPPP 1211 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP-PXPXXXXXPPXXPXXXP 922 P P PPPP P P P PP P P Sbjct: 1130 PPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPP 1162 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +1 Query: 826 PXPXXLXXPPXPXPS---PXXXPXP--XPPXXPXPXPP 924 P P L P P PS P P P PP P P PP Sbjct: 1137 PPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPP 1174 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PP PPP PP P Sbjct: 1159 PLPPSPPPATPPPPPPLSPSLPPPPPPP 1186 >07_03_1751 - 29215074-29216270 Length = 398 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 109 GGVGGGFGGGKGGGLGGGGGLGGGGGGGAGG 139 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 189 GGLGGGAGGGAGVGGGAGGGAGGGGGLGGGAGG 221 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 203 GGAGGGAGGGGGLGGGAGGGAGGGGGLGGGAGG 235 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 217 GGAGGGAGGGGGLGGGAGGGHGGGGGLGGGAGG 249 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 359 GGKGGGFGGGVGGGHGAGGGGAGGGGGFGGGAG 391 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG GG G Sbjct: 103 GGIGHGGGVGGGFGGGKGGGLGGGGGLGGGGGG 135 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 277 GGIGGGAGGGAGAGGGFGGGKGGGFGGGGGGGG 309 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXG-GGGXXEXGGXG 826 GG G GG G GGG G GGG GG G Sbjct: 241 GGLGGGAGGGAGVGGGAGGGAGAGGGLGAGGGAG 274 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 113 GGFGGGKGGGLGGGGGLGGGGGGGAGGGLGG 143 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 125 GGGGLGGGGGGGAGGGLGGGAGGGAGAGVGG 155 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 GG G GG G GGG GGG G GG G Sbjct: 67 GGFGGGAGGGLGHGGGIGGGFGGGKGGGLGGGVG 100 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 116 GGGKGGGLGGGGGLGGGGGGGAGGGLGGGAGGG 148 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG G G Sbjct: 143 GGAGGGAGAGVGGGAGAGGGAGGGGGLGGGAGG 175 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG G G Sbjct: 165 GGGGLGGGAGGGAGGGLGGGSGGGGGLGGGAGG 197 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 175 GGAGGGLGGGSGGGGGLGGGAGGGAGVGGGAGG 207 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 196 GGGAGVGGGAGGGAGGGGGLGGGAGGGAGGGG 227 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 210 GGGGGLGGGAGGGAGGGGGLGGGAGGGHGGGG 241 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 227 GGLGGGAGGGHGGGGGLGGGAGGGAGVGGGAGG 259 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGG GG G Sbjct: 188 GGGLGGGAGGGAGVGGGAGGGAGGGGGLGGGAG 220 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGG GG G Sbjct: 202 GGGAGGGAGGGGGLGGGAGGGAGGGGGLGGGAG 234 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G G GG G Sbjct: 290 GGGFGGGKGGGFGGGGGGGGGAGAGGGFGGGKG 322 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G + GG G Sbjct: 64 GGGGGFGGGAGGGLGHGGGIGGGFGGGKGGGLG 96 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 96 GGGVGVGGGIGHGGGVGGGFGGGKGGGLGGGG 127 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 274 GGGGGIGGGAGGGAGAGGGFGGGKGGGFGGGG 305 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G G G GGG GGGG GG Sbjct: 285 GGAGAGGGFGGGKGGGFGGGGGGGGGAGAGG 315 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG GGG GGGG GG G Sbjct: 286 GAGAGGGFGGGKGGGFGGGGGGGGGAGAGGGFG 318 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG G G Sbjct: 291 GGFGGGKGGGFGGGGGGGGGAGAGGGFGGGKGG 323 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 GG G G G GGG GGG G + GG G Sbjct: 305 GGGGGGAGAGGGFGGGKGGGFGGGFGGGKGGGVG 338 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG G G Sbjct: 331 GGKGGGVGGGAGGGFGGGGGAGAGGGFGGGKGG 363 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G GG G Sbjct: 158 GAGGGAGGGGGLGGGAGGGAGGGLGGGSGGGGG 190 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 171 GGAGGGAGGGLGGGSGGGGGLGGGAGGGAGVGG 203 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGG GG G Sbjct: 216 GGGAGGGAGGGGGLGGGAGGGHGGGGGLGGGAG 248 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG GG G Sbjct: 281 GGAGGGAGAGGGFGGGKGGGFGGGGGG-GGGAG 312 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 326 GGGFGGGKGGGVGG-GAGGGFGGGGGAGAGG 355 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG GG G Sbjct: 354 GGGFGGGKGGGFGG-GVGGGHGAGGGGAGGGGG 385 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 213 GGLGGGAGGGAGGGGGLGGG-AGGGHGGGGGLG 244 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 318 GGGKGGGFGGGFGG-GKGGGVGGGAGGGFGGGG 349 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 GG G GG G G G GGG G GG G Sbjct: 362 GGGFGGGVGGGHGAGGGGAGGGGGFGGGAGGGIG 395 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGG GG Sbjct: 154 GGGAGAGGGAGGGGGLGGGAGGGAGGGLGG 183 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG G GG GG Sbjct: 248 GGGAGVGGGAGGGAGAGGGLGAGGGAGGGG 277 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G GG G Sbjct: 342 GGGFGGGGGAGAGGGFGGGKGGGFGGGVGGGHG 374 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG GG G Sbjct: 349 GGAGAGGGFGGGKGGGFGGGVGGGHGAGGGGAG 381 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G G G GGG GGG GG Sbjct: 366 GGGVGGGHGAGGGGAGGGGGFGGGAGGGIGG 396 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G G G GGG GG G Sbjct: 182 GGGSGGGGGLGGGAGGGAGVGGGAGGGAGGGG 213 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG G G Sbjct: 254 GGGAGGGAGAGGGLGAGGGAGGGGGIGGGAGG 285 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G GG G Sbjct: 298 GGGFGGGGGGGGGAGAGGGFGGGKGGGFGGGFG 330 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G GG G Sbjct: 302 GGGGGGGGGAGAGGGFGGGKGGGFGGGFGGGKG 334 >07_03_0890 - 22332768-22333382 Length = 204 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPP PPP P P PP Sbjct: 75 PPPPPAEATPPPPPPPPPPERAVPEAADTPPPP 107 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP Sbjct: 76 PPPPAEATPPPPPPPPPPERAVPEAADTPPPPP 108 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP P PP Sbjct: 77 PPPAEATPPPPPPPPPPERAVPEAADTPPPPPP 109 >06_03_0310 - 19453047-19453160,19453240-19453338,19453441-19453513, 19453598-19453708,19453795-19453956,19454064-19454340, 19454542-19455160,19455256-19455471 Length = 556 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P+P P P PP P P PP Sbjct: 176 PQAPAPTPPQAPAPTPPRAPTPTPP 200 Score = 33.1 bits (72), Expect = 0.32 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P P P P+P P P PP P P P Sbjct: 153 PPAPPSPPQDPAPSLPHAPAPPPPQAPAPTP-----PQAPAPTPPRAPTPTPPQAPLPAP 207 Score = 32.3 bits (70), Expect = 0.56 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P P PP P P PP Sbjct: 168 PHAPAPPPPQAPAPTPPQAPAPTPP 192 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 826 PXPXXLXXPPX-PXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PS P P PP P P PP Sbjct: 151 PSPPAPPSPPQDPAPSLPHAPAPPPPQAPAPTPP 184 >06_02_0175 - 12624608-12625297 Length = 229 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 95 GGGSSGGGGGGGGGGGGGGGGGGGGGGGGGG 125 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 96 GGSSGGGGGGGGGGGGGGGGGGGGGGGGGGG 126 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GGG GGGG GG G Sbjct: 94 GGGGSSGGGGGGGGGGGGGGGGGGGGGGGGGGG 126 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGRRCWWGCG 134 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG GG G Sbjct: 86 GWGWGTDSGGGGSSGGGGGGGGGGGGGGGGGG 117 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG GG G Sbjct: 90 GTDSGGGGSSGGGGGGGGGGGGGGGGGGGGGG 121 >04_04_1126 + 31095651-31096115 Length = 154 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P PP P P P Sbjct: 42 PPPPPPAPSGVPCPPPPYTPTPATP 66 >03_02_0765 + 11000724-11002496 Length = 590 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 114 GGFGGGKGGGLGGGGGLGGGAGGGGGLGSGG 144 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 220 GGLGGGAGGGGGAGGGLGGGAGGGGGLGGGAGG 252 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 58 GGAGGGFGGGLGHGGGLGGGFGGGKGGGLGGGG 90 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 96 GGAGGGFGGGLGHGGGLGGGFGGGKGGGLGGGG 128 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 72 GGLGGGFGGGKGGGLGGGGGLGGGG-GAGGGFG 103 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 148 GGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGGG 180 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 GG G GG G GGG GGG G GG G Sbjct: 162 GGLGGGAGGGLGGGAGGGGGVGGGLGGGAGGGLG 195 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 170 GGLGGGAGGGGGVGGGLGGGAGGGLGSGAGGGG 202 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 212 GGLGGGAGGGLGGGAGGGGGAGGGLGGGAGGGG 244 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 230 GGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGGG 262 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 144 GGLGGGAGGGLGGGAGGGGGLGGGAGGGLGG 174 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 252 GGLGGGAGGGGGLSGGAGGGLGGGAGAGGGG 282 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 302 GGLGGGAGGGLGGGAGAGGGLGGGAGAGGGG 332 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG G GG GG Sbjct: 306 GGAGGGLGGGAGAGGGLGGGAGAGGGGGLGG 336 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 324 GGAGAGGGGGLGGGAGGGGGLGGGAGGGLGG 354 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 342 GGLGGGAGGGLGGGAGAGGGLGGGAGAGGGG 372 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG G GG GG Sbjct: 346 GGAGGGLGGGAGAGGGLGGGAGAGGGGGLGG 376 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 364 GGAGAGGGGGLGGGAGGGGGLGGGAGGGLGG 394 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 382 GGLGGGAGGGLGGGAGAGGGLGGGAGTGGGG 412 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 404 GGAGTGGGGGLGGGAGGGGGLGGGAGGGLGG 434 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 422 GGLGGGAGGGLGGGAGAGGGFGGGAGAGGGG 452 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG G GG GG Sbjct: 426 GGAGGGLGGGAGAGGGFGGGAGAGGGGGLGG 456 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG G G Sbjct: 188 GGAGGGLGSGAGGGGGLGGGAGGGGGLGGGAGG 220 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 202 GGLGGGAGGGGGLGGGAGGGLGGGAGGGGGAGG 234 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG G G Sbjct: 279 GGGGGLGGGTGGGGGLGGGTGGGGGLGGGAGG 310 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG G G Sbjct: 476 GGFGGGAGAGTGGGGGLGGGAGGGGGLGGGAGG 508 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 GG G GG G GGG GGG G GG G Sbjct: 500 GGLGGGAGGGLGGGAGAGGGFGGGKGGGFGGGLG 533 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G G G GGGG GG G Sbjct: 545 GAGGGAGGGAGAGFGGGAGAGGGGGLGAGGGG 576 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 GG G GG G GGG GGGG Sbjct: 560 GGAGAGGGGGLGAGGGGGGGFGGGG 584 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G + GG G Sbjct: 55 GGGGGAGGGFGGGLGHGGGLGGGFGGGKGGGLG 87 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G + GG G Sbjct: 93 GGGGGAGGGFGGGLGHGGGLGGGFGGGKGGGLG 125 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG G G Sbjct: 238 GGAGGGGGLGGGAGGGLGGGAGGGGGLSGGAGG 270 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG + G G Sbjct: 439 GGGFGGGAGAGGGGGLGGGAGGGGGLDGGAGG 470 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 504 GGAGGGLGGGAGAGGGFGGGKGGGFGGGLGG 534 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG GG G Sbjct: 38 GGGGFGGGGGFGGGGGLGGGGGAGGGF-GGGLG 69 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 44 GGGGFGGGGGLGGGGGAGGGFGGG-LGHGGGLG 75 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G G G GGG GGGG GG Sbjct: 66 GGLGHGGGLGGGFGGGKGGGLGGGGGLGGGG 96 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG GG G Sbjct: 76 GGFGGGKGGGLGGGGGLGGGGGAGGGF-GGGLG 107 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXG-GGGXXEXGGXG 826 GG G GG G G G G GGG GG G Sbjct: 80 GGKGGGLGGGGGLGGGGGAGGGFGGGLGHGGGLG 113 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 110 GGLGGGFGGGKGGGLGGGGGLGGGAGG-GGGLG 141 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 152 GGLGGGAGGGGGLGGGAGGGLGGGAGG-GGGVG 183 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 184 GGLGGGAGGGLGSGAGGGGGLGGGAGG-GGGLG 215 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 216 GGAGGGLGGGAGGGGGAGGGLGGGAGG-GGGLG 247 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 292 GGLGGGTGGGGGLGGGAGGGLGGGA-GAGGGLG 323 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 332 GGLGGGAGGGGGLGGGAGGGLGGGAGA-GGGLG 363 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 372 GGLGGGAGGGGGLGGGAGGGLGGGAGA-GGGLG 403 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 412 GGLGGGAGGGGGLGGGAGGGLGGGAGA-GGGFG 443 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 490 GGLGGGAGGGGGLGGGAGGGLGGGAGA-GGGFG 521 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXG---GGXGGGGXXEXGGXG 826 GG G GG G G GG GGGG GG G Sbjct: 552 GGAGAGFGGGAGAGGGGGLGAGGGGGGGFGGGGGVG 587 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG G G Sbjct: 104 GGLGHGGGLGGGFGGGKGGGLGGGGGLGGGAGG 136 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 131 GGGAGGGGGLGSGGGLGGGAGGGLGGGAGGGG 162 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG G G Sbjct: 138 GGLGSGGGLGGGAGGGLGGGAGGGGGLGGGAGG 170 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G G G GGG GG G Sbjct: 180 GGVGGGLGGGAGGGLGSGAGGGGGLGGGAGGGG 212 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 199 GGGGGLGGGAGGGGGLGGGAGGGLGGGAGGGG 230 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 234 GGLGGGAGGGGGLGGGAGGGLGGGAGGGGGLSG 266 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXG---GGGXXEXGGXG 826 GG G GG G GGG G GGG GG G Sbjct: 274 GGAGAGGGGGLGGGTGGGGGLGGGTGGGGGLGGGAG 309 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXG---GGGXXEXGGXG 826 GG G GG G GGG G GGG GG G Sbjct: 462 GGLDGGAGGGAEAGGGFGGGAGAGTGGGGGLGGGAG 497 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G G G GGG GGG GG Sbjct: 126 GGGGLGGGAGGGGGLGSGGGLGGGAGGGLGG 156 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGG GG Sbjct: 195 GSGAGGGGGLGGGAGGGGGLGGGAGGGLGG 224 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGG GG Sbjct: 227 GGGGGAGGGLGGGAGGGGGLGGGAGGGLGG 256 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GG GG Sbjct: 244 GGLGGGAGGGLGGGAGGGGGLSGGAGGGLGG 274 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXG-GGGXXEXGGXG 826 G G GG G GGG G GGG GG G Sbjct: 273 GGGAGAGGGGGLGGGTGGGGGLGGGTGGGGGLG 305 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGG GG Sbjct: 285 GGGTGGGGGLGGGTGGGGGLGGGAGGGLGG 314 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXG-GGGXXEXGGXG 826 G G GG G GGG G GGG GG G Sbjct: 313 GGGAGAGGGLGGGAGAGGGGGLGGGAGGGGGLG 345 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXG-GGGXXEXGGXG 826 G G GG G GGG G GGG GG G Sbjct: 353 GGGAGAGGGLGGGAGAGGGGGLGGGAGGGGGLG 385 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXG-GGGXXEXGGXG 826 G G GG G GGG G GGG GG G Sbjct: 393 GGGAGAGGGLGGGAGTGGGGGLGGGAGGGGGLG 425 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGG--XGGGGXXEXGG 832 GG G GG G GGG G GG E GG Sbjct: 444 GGAGAGGGGGLGGGAGGGGGLDGGAGGGAEAGG 476 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGG GG Sbjct: 483 GAGTGGGGGLGGGAGGGGGLGGGAGGGLGG 512 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG G GG G G Sbjct: 121 GGGLGGGGGLGGGAGGGGGLGSGGGLGGGAGG 152 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG G GG G G Sbjct: 210 GGGGLGGGAGGGLGGGAGGGGGAGGGLGGGAGG 242 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGG G G Sbjct: 211 GGGLGGGAGGGLGGGAGGGGGAGGGLGGGAGGG 243 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG G G Sbjct: 319 GGGLGGGAGAGGGGGLGGGAGGGGGLGGGAGG 350 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG G G Sbjct: 359 GGGLGGGAGAGGGGGLGGGAGGGGGLGGGAGG 390 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG G G Sbjct: 399 GGGLGGGAGTGGGGGLGGGAGGGGGLGGGAGG 430 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G G G GGGG G G Sbjct: 466 GGAGGGAEAGGGFGGGAGAGTGGGGGLGGGAGG 498 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG G GG G G Sbjct: 542 GGFGAGGGAGGGAGAGFGGGAGAGGGGGLGAGG 574 >03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655, 9041608-9041802,9041905-9042153,9042525-9042672, 9042673-9042779,9043311-9043475,9044506-9045948 Length = 1273 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 92 GGGAGGPLGGGGGGWGAGGGGGGGGGGGGGG 122 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG GG G Sbjct: 88 GGGFGGGAGGPLG--GGGGGWGAGGGGGGGGGG 118 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP--PXPXXXXXPPXXPXXXPP 925 P PP PP P PP P P PP P PP Sbjct: 198 PTPPTIARPPRPLPPASPPPPSIATPPPSPASPPP 232 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXP 910 P PP PPP P PP P PP P Sbjct: 215 PPPPSIATPPPSPASPPPPSTATPPPPSP 243 >08_01_0202 - 1638978-1639571 Length = 197 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 154 GGGGGGYGGGGGGYRGGGGGGGGGGCYNCGETG 186 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 93 GGGGGGRYGGDRGYGGGGGGYGGGDRGYGGGGG 125 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG GG G Sbjct: 92 GGGGGGGRYGGDRGYGGGGGGYGGGDRGYGGGG 124 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGG 850 G G GG G GGG GGGG Sbjct: 107 GGGGGGYGGGDRGYGGGGGYGGGG 130 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 33.1 bits (72), Expect = 0.32 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP + PPPP PPP P Sbjct: 56 PPPPRTLPPPPPPPPPQP 73 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +2 Query: 827 PXPPXSXXPPPP---XPPPXPXXXXXPP 901 P PP PPPP PPP P PP Sbjct: 47 PPPPQPTLPPPPPRTLPPPPPPPPPQPP 74 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +2 Query: 851 PPPPXP---PPXPXXXXXPPXXPXXXPP 925 PPPP P PP P PP P PP Sbjct: 47 PPPPQPTLPPPPPRTLPPPPPPPPPQPP 74 >07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398, 5534564-5534731,5535951-5536193,5537178-5537261, 5537357-5538117,5539637-5539730,5540633-5540899, 5541311-5541316,5542538-5542657 Length = 801 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 763 GGGGGGYGGGGYGGGGGGGGYGGGSSYGGGGQG 795 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 GG G GG G GGG GGGG Sbjct: 758 GGGGYGGGGGGYGGGGYGGGGGGGG 782 >06_01_0178 + 1386981-1387505 Length = 174 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGGG GG G Sbjct: 19 GGRGRGGRGGRGGRGGASGGGGGGGGGGGGGGG 51 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 30 GGRGGASGGGGGGGGGGGGGGGGGAGGKGGKG 61 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGG-XGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 75 GGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGRG 108 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG GG G Sbjct: 27 GGRGGRGGASGGGGGGGGGGGGGGGGGAGGKG 58 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG G GG GG G Sbjct: 33 GGASGGGGGGGGGGGGGGGGGAGGKGGKGGAG 64 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG GG Sbjct: 22 GRGGRGGRGGRGGASGGGGGGGGGGGGGGGG 52 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG GG G Sbjct: 24 GGRGGRGGRGGASGGGGGGGGGGGGGGGGGAG 55 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGG-XGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 53 GAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAG 86 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GG GG G GG G Sbjct: 46 GGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGG 78 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GG GG G GG G Sbjct: 68 GAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGG 100 >05_05_0173 + 22956927-22958615 Length = 562 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPX--PPXXPXPXPP 924 P P L PP P P P P PP P P PP Sbjct: 70 PPPAELVRPPTPLPEPYDPSAPEAHPPYVPPPVPP 104 >04_04_1413 - 33386049-33386339 Length = 96 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 62 GGGGGGGGGGGGCGGGGGGGGGGGCGGGGGSG 93 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GGG GGGG GG G Sbjct: 55 GGRRRRTGGGGGGGGGGGGCGGGGG 79 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G GGG GGGG GG G Sbjct: 53 GSGGRRRRTGGGGGGGGGGGGCGGGGGG 80 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 GG G GG G GGG G GG Sbjct: 70 GGGGCGGGGGGGGGGGCGGGGGSGG 94 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG 853 GG G GG G GGG GGG Sbjct: 72 GGCGGGGGGGGGGGCGGGGGSGGG 95 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGGG GG G Sbjct: 157 GGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGG 189 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGGG GG G Sbjct: 158 GGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGG 190 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG GG G Sbjct: 165 GGGGGDGNVGGGGGGGGGGGGGGGGGGG 192 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 GG G GG G GGG GGGG G Sbjct: 166 GGGGDGNVGGGGGGGGGGGGGGGGGGGGDG 195 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G G G GGG GGGG GG Sbjct: 162 GGDGGGGGDGNVGGGGGGGGGGGGGGGGGGG 192 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG GG G Sbjct: 162 GGDGGGGGDGNVGGGGGGGGGGGGGGGGGGGG 193 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 879 GXGGGXGGGGXXEXGGXG 826 G GGG GGGG + GG G Sbjct: 148 GGGGGGGGGGGGDVGGDG 165 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 33.1 bits (72), Expect = 0.32 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXP 898 P PP PPPP PPP P P Sbjct: 39 PPPPPPPPPPPPPPPPPPLEVVSP 62 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPPP PPP P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPLEVVSP 62 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXP 922 PPPP PPP P PP P Sbjct: 39 PPPPPPPPPPPPPPPPPPLEVVSP 62 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXP 910 P + PPP PPP P PP P Sbjct: 32 PFTFLCPPPPPPPPPPPPPPPPPPP 56 >12_02_0756 + 22839673-22839870,22839961-22842194,22842280-22842531, 22842612-22842722,22842812-22842893,22843168-22843359 Length = 1022 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 568 PAPPSPPEPPSPQHPPSPPPLRSPPRQPTPPP 599 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 574 PEPPSPQHPPSPPPLRSPPRQPTPPPSPSQQPP 606 >12_02_0193 + 15242068-15242265,15242356-15244589,15244675-15244926, 15245007-15245117,15245207-15245288,15245563-15245754 Length = 1022 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 599 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 >12_01_0927 + 9196230-9196427,9196499-9197190,9197317-9198351, 9198437-9198688,9198769-9198879,9198969-9199050, 9199325-9199516 Length = 853 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 399 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 430 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 405 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 437 >11_06_0069 + 19770182-19770379,19770470-19772703,19772789-19773040, 19773121-19773231,19773321-19773402,19773677-19773868 Length = 1022 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 599 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 >11_04_0270 - 15590955-15591146,15591421-15591502,15591592-15591702, 15591783-15592034,15592120-15594353,15594444-15594641 Length = 1022 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 599 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 >10_07_0154 + 13487971-13488168,13488259-13488483,13488592-13490492, 13490578-13490829,13491110-13491191,13491466-13491657 Length = 949 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 532 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 563 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 538 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 570 >10_01_0112 - 1386762-1386953,1387228-1387309,1387399-1387509, 1387590-1387841,1387927-1388348,1388430-1390160, 1390251-1390448 Length = 995 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 599 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P P P PP Sbjct: 55 PPPPPPPPAPFFPFLPDSAPPQLPP 79 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXP 898 PP S PPPP PPP P P Sbjct: 258 PPQSVRPPPPPPPPPPPPPMPP 279 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P PPPP PPP P Sbjct: 257 PPPQSVRPPPPPPPPPPP 274 >09_04_0487 - 18014469-18014660,18014935-18015016,18015297-18015548, 18015634-18017789 Length = 893 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 476 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 507 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 482 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 514 >09_02_0349 - 7632140-7632234,7632348-7632449,7632864-7632962, 7633517-7633622,7633897-7633978,7634068-7634178, 7634259-7634510,7634596-7635688,7636157-7636829, 7636920-7637117 Length = 936 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 412 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 443 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 418 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 450 >09_02_0131 - 4693828-4694019,4694107-4694199,4694294-4694375, 4694465-4694575,4694656-4694907,4694993-4697196 Length = 977 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 481 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 512 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 487 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 519 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXP 898 P PP PPPP PPP P P Sbjct: 95 PSPPLLALPPPPPPPPPPPPPPQP 118 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PXPXPSPXXXPXPXPPXXPXPXPP 924 P PSP P PP P P PP Sbjct: 91 PEAPPSPPLLALPPPPPPPPPPPP 114 >08_02_0450 - 17266977-17267165,17268017-17268053,17268139-17269514, 17285369-17286055,17286146-17286343 Length = 828 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 522 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 553 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 528 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 560 >08_02_0194 + 14084828-14085025,14085116-14085788,14085855-14087082, 14087435-14087686,14087767-14087877,14087967-14088048, 14088323-14088514 Length = 911 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 546 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 577 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 552 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 584 >08_01_0440 + 3875422-3875619,3875710-3876382,3876449-3877943, 3878029-3878280,3878361-3878471,3878561-3878642, 3878917-3879108 Length = 1000 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 546 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 577 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 552 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 584 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P P P PP Sbjct: 230 PPPPPPPPKPANIAGAPGLPLPPPP 254 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PPPP PPP P P PP Sbjct: 246 PGLPLPPPPPPPPGPPPREIVPGQTLLPPP 275 >06_03_1042 - 27089563-27089594,27090017-27090577,27090740-27090797 Length = 216 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P P PP Sbjct: 51 PPPPYCVYPPPPTKPALPAPLPPTPASPGDSPP 83 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP P P Sbjct: 55 PPPPPPPPQPAKEPPPPTKPKHPKP 79 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP--PXPXXXXXPPXXPXXXPP 925 P P + PPPP P P P PP P PP Sbjct: 60 PPPQPAKEPPPPTKPKHPKPKQQQHPPPPPPQKPP 94 >06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926, 9999007-9999117,9999207-9999288,9999563-9999754 Length = 1022 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 599 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 >06_01_1155 + 9777611-9777808,9777899-9780132,9780218-9780469, 9780550-9780660,9780750-9780831,9781106-9781297 Length = 1022 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 599 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 >06_01_0486 - 3455030-3455770 Length = 246 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP---PXPXXXXXPPXXPXXXPP 925 P PP P PP PP P P PP P PP Sbjct: 119 PTPPYVPPPTPPSPPPYVPPPTPPSPPPYVPPPSPP 154 Score = 32.3 bits (70), Expect = 0.56 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPX-PXPSPXXXPXPXPPXXPXPX 918 PP P P P P PP P P+P P P PP P Sbjct: 77 PPYTPPTPRPPPTPPYVPSPPPYVPPYIPPPTPPYVPPYIPPPTPPYVPPPTPPSPPPYV 136 Query: 919 PP 924 PP Sbjct: 137 PP 138 Score = 29.5 bits (63), Expect = 4.0 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPS-PXXXPXPXPPXXPXPX 918 PP P PP P P PP PS P P P PP P Sbjct: 90 PPYVPSPPPYVPPYIPPPTPPYVPPYIPP-PTPPYVPPPTPPSPPPYVPPPTPPSPPPYV 148 Query: 919 PP 924 PP Sbjct: 149 PP 150 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP P PP PP P PP P PP Sbjct: 113 PPYIPPPTPPYVPP-PTPPSPPPYVPPPTPP 142 >05_01_0577 + 5159934-5160131,5160222-5162455,5162541-5162792, 5162873-5162983,5163073-5163154,5163429-5163620 Length = 1022 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 599 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 >05_01_0571 - 5067558-5067749,5068024-5068105,5068195-5068305, 5068386-5068637,5068723-5070956,5071047-5071244 Length = 1022 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 599 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GGG GGGG GG G Sbjct: 60 GGGRGYGGGGGGGGRGYGGGGGGGGYESGGGRG 92 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGG 832 GG G GGG GGGG GG Sbjct: 8 GGRGRGRGRGGGRGGGGGDGRGG 30 >04_01_0365 - 4796780-4796971,4797246-4797327,4797417-4797527, 4797608-4797859,4797945-4800115 Length = 935 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 481 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 512 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 487 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 519 >02_01_0374 - 2702804-2702995,2703270-2703351,2703441-2703551, 2703632-2703883,2703969-2704798,2704895-2706202, 2706293-2706490 Length = 990 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 536 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 567 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 542 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 574 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP-XXXXXPPXXPXXXP 922 P PP + P PP PPP P PP P P Sbjct: 125 PQPPRAWDPSPPPPPPAPAAPVLVPPPAPAPRP 157 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P PP P PP Sbjct: 112 PPPPRKKPQFQPPPQPPRAWDPSPP 136 >01_06_1321 + 36280691-36281269 Length = 192 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXP 898 PP S PPPP PPP P P Sbjct: 143 PPPSPPPPPPPPPPLPPAMYVP 164 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P P P P P PP Sbjct: 23 PPPPTPHPATDPPPISPQNPTPPPP 47 >01_06_0075 - 26201231-26201422,26201697-26201778,26201868-26201978, 26202059-26202310,26202396-26204629,26204720-26204917 Length = 1022 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 599 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 >01_05_0224 + 19485296-19485493,19485584-19487817,19487903-19488154, 19488235-19488345,19488435-19488516,19488791-19488982 Length = 1022 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P PP P PP P P Sbjct: 568 PAPPSPPKPPSPRHPPSPPPLRSPPRQPTPPP 599 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 574 PKPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 >12_01_0841 - 7873458-7874225 Length = 255 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG + GG G Sbjct: 44 GGEGGGGGSGYGEGYGQGGGASGGGYGQGGGGG 76 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG + GG G Sbjct: 157 GGNGSGYGSGYGSGYGQGGGASGGGYGQGGGGG 189 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG + GG G Sbjct: 79 GGQGGGSGSGYGSGYGQGGGASGGGYGKGGGGG 111 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GG + GG G Sbjct: 196 GGNGSGYGSGYGSGYGQGGGVHAGGYGQGGGGG 228 >12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 Length = 1035 Score = 32.3 bits (70), Expect = 0.56 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PPP P Sbjct: 3 PLPPLPSPPPPPTPPPSP 20 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGG 832 GG G GGG GGGG GG Sbjct: 60 GGGGGGGGGGGGGGGGGRGGRGG 82 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP + PPPP PP P PP P P Sbjct: 618 PRPPGA--PPPPPPPGKPGGPPPPPPRPGSLP 647 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PP PP P PP Sbjct: 611 SALPPPPPRPPGAPPPPPPPGKPGGPPP 638 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P +P P P P P P PP Sbjct: 617 PPRPPGAPPPPPPPGKPGGPPPPPP 641 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP + PPPP PP P PP P P Sbjct: 923 PRPPGA--PPPPPPPGKPGGPPPPPPPPGSLP 952 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P +P P P P P P PP Sbjct: 922 PPRPPGAPPPPPPPGKPGGPPPPPP 946 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 32.3 bits (70), Expect = 0.56 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXP 910 PP PP P PPP P PP P Sbjct: 73 PPPPQTPPSPPPPPPPPPPPPPPLSP 98 Score = 31.5 bits (68), Expect = 0.98 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P P S PPPP PPP P P Sbjct: 76 PQTPPSPPPPPPPPPPPPPPLSPTP 100 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXP 915 PP P P P P P PP P P Sbjct: 79 PPSPPPPPPPPPPPPPPLSPTP 100 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P S PPPP PP P PP P Sbjct: 65 PHHHVSAAPPPPQTPPSPPPPPPPPPPP 92 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P P PP P P PP Sbjct: 63 PHPHHHVSAAPPPPQTPPSPPPPPPPPPPPPPP 95 >08_01_0531 - 4604556-4604582,4604829-4604921,4605381-4605572, 4605800-4606390 Length = 300 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG GGG GGGG E GG G Sbjct: 99 GRGGGGGGGAAGGGGRGGGGDEEMGGEG 126 >06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104, 25541673-25541751,25542151-25542238,25542330-25542600, 25542676-25542718,25542801-25542904,25543374-25543790 Length = 2068 Score = 32.3 bits (70), Expect = 0.56 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP PP Sbjct: 91 PPPPPPPPLPQHRLEPPPPHYGFPP 115 >06_02_0125 + 12122812-12122911,12123647-12123993 Length = 148 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 113 GGYGGGYGGGYGGGYGGGGGYGGGGGYGGGHGG 145 >05_01_0380 + 2978256-2979284 Length = 342 Score = 32.3 bits (70), Expect = 0.56 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXP 910 PP PPPP PPP P P P Sbjct: 26 PPPPPPPPPPPPPPPPRPFSRKPSEP 51 Score = 32.3 bits (70), Expect = 0.56 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPRP 43 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P P P P Sbjct: 396 PAPPPPPQPPPP-PPPPPHQRETPSPSPPPQP 426 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P P P P PP Sbjct: 399 PPPPQPPPPPPPPPHQRETPSPSPP 423 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P PP P P Sbjct: 399 PPPPQPPPPPPPPPHQRETPSPSPPPQPQFPCP 431 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP P P P P PP Sbjct: 265 PRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPP 297 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP P PP PP Sbjct: 274 PPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPP 306 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PP P PP P PP Sbjct: 116 PPRPPPPPPPHPPEDP--PPHPPHPPDHPPP 144 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PP P PP PP Sbjct: 122 PPPPHPPEDPPPHPPHPPDHPPPPPPCRVPPPP 154 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 117 PRPPPPPPPHPPEDPPPHP---PHPPDHPPPPPP 147 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPP--PPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP PP PP P PP P PP Sbjct: 119 PPPPPPPHPPEDPPPHPPHPPD-HPPPPPPCRVPP 152 >12_01_0319 + 2440129-2440661,2440875-2440902 Length = 186 Score = 26.6 bits (56), Expect(2) = 0.63 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXP 898 PPPP PPP P P Sbjct: 46 PPPPPPPPPPRAAAAP 61 Score = 24.2 bits (50), Expect(2) = 0.63 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 842 SXXPPPPXPPP 874 S PPPP PPP Sbjct: 44 SGPPPPPPPPP 54 >07_03_0111 + 13535912-13535972,13536081-13536142,13536418-13536510, 13537577-13537649,13537876-13538265,13538337-13538404, 13539334-13539375,13540211-13540735,13540817-13540974, 13541078-13541636,13542438-13542500,13542579-13542680, 13542779-13543096,13543175-13543267,13543489-13543590, 13543678-13543782,13544190-13544323,13545097-13545280, 13545701-13545832,13546215-13546327,13546468-13546558, 13547138-13549339 Length = 1889 Score = 26.2 bits (55), Expect(2) = 0.69 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPP 901 PPPP PPP P P Sbjct: 124 PPPPPPPPSPKDAAADP 140 Score = 24.2 bits (50), Expect(2) = 0.69 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 842 SXXPPPPXPPP 874 S PPPP PPP Sbjct: 120 SFGPPPPPPPP 130 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP P P P PP Sbjct: 396 PPPPPTPPPPPPLLAPKQQSSGGPILPPAPAPP 428 Score = 27.5 bits (58), Expect(2) = 0.73 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 833 PPXSXXPPPPXPPP 874 PP PPPP PPP Sbjct: 365 PPPPPPPPPPPPPP 378 Score = 23.0 bits (47), Expect(2) = 0.73 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPP 901 PPPP P P P P Sbjct: 395 PPPPPPTPPPPPPLLAP 411 >12_02_1219 + 27096477-27096590,27096704-27097078 Length = 162 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG GG G Sbjct: 91 GGGGGGYGQRGGGGGYGGGGGYGGGGGG 118 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GGG GGGG GG G Sbjct: 118 GGYGQRREGGYGGGGGYGGGRGGGGGY-GGGYG 149 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G GG G GGG GGG G GG G Sbjct: 101 GGGGGYGGGGGYGGGGGGGYGQRREGGYG 129 >09_06_0283 + 22024779-22026134,22026181-22026714 Length = 629 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG GG G Sbjct: 23 GFLGGGGGGGGGGGGGGGGGGGGGGGGG 50 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXE 841 GG G GG G GGG GGGG E Sbjct: 27 GGGGGGGGGGGGGGGGGGGGGGGGGAVE 54 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 GG G GG G GGG GGGG Sbjct: 26 GGGGGGGGGGGGGGGGGGGGGGGGG 50 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GGG GGGG GG G Sbjct: 27 GGGGGGGGGGGGGGGGGGGGGGGGG 51 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGG 832 G GG G GGG GGGG GG Sbjct: 26 GGGGGGGGGGGGGGGGGGGGGGGGGG 51 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXE 841 GG G GG G GGG GGG E Sbjct: 28 GGGGGGGGGGGGGGGGGGGGGGGGAVEE 55 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 G G GG G GGG GGGG G Sbjct: 23 GFLGGGGGGGGGGGGGGGGGGGGGGGGGG 51 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +1 Query: 850 PPXPXPSPXXXP---XPXPPXXPXPXPP 924 PP P PSP P P PP P P PP Sbjct: 223 PPPPPPSPHRHPAAHPPPPPHHPAPRPP 250 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P P PPP PPP P PP Sbjct: 141 PPPHVPKAAPPPPPPPPPHAPPGPP 165 >07_03_0329 + 16840051-16840917,16840999-16841342,16841444-16841574, 16841671-16841792,16841877-16841983,16842104-16842236, 16842342-16842458,16842560-16842667,16842716-16842742, 16842759-16842830,16843462-16843584,16843671-16843833, 16844140-16844264,16844355-16844489,16844574-16844677, 16844772-16844834,16844930-16844993,16845186-16845318, 16845414-16845487,16845603-16845697,16845799-16845830, 16846201-16846355 Length = 1097 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG + G Sbjct: 57 GGYGGGGGGGGPPYYGGGGGGGGGGGGQGRG 87 >06_03_0674 + 23422004-23422552,23423295-23423369,23424360-23424443, 23424749-23424991,23425348-23425515,23425608-23425727, 23426372-23427016 Length = 627 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGG-XGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 545 GGYSGGGGGGGYSGGGGGGGYSGGGGGYSGGGRG 578 >05_04_0303 - 20010761-20011756 Length = 331 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 46 GGGGGGVGGGVVGGDGVGGGGGGGGGG-GGGVG 77 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 GG G GG G GGG GGGG G Sbjct: 50 GGVGGGVVGGDGVGGGGGGGGGGGGGVGAG 79 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P L PP P S P P P P P PP Sbjct: 91 PPPPLLPTPPPPPASISPTPAPPLPPPPAPAPP 123 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P PP P P PP Sbjct: 58 PPPPLPTPTVTTPTPPPPPPAPRPP 82 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 4/36 (11%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP----PXPXXXXXPPXXPXXXP 922 P PP P PP PP P P PP P P Sbjct: 89 PPPPPPLLPTPPPPPASISPTPAPPLPPPPAPAPPP 124 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 4/29 (13%) Frame = +1 Query: 850 PPXPXPSPXXX----PXPXPPXXPXPXPP 924 PP P P P P P PP P P PP Sbjct: 74 PPPPAPRPPRRHHRIPPPPPPLLPTPPPP 102 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP + P P PP P PP P Sbjct: 99 PPPPPASISPTPAPPLPPPPAPAPPPTP 126 >04_04_0675 + 27183826-27184443 Length = 205 Score = 31.9 bits (69), Expect = 0.74 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 853 PXPXPSPXXXPXPXPPXXPXPXPP 924 P P SP P P PP P P PP Sbjct: 97 PSPSASPSQSPSPPPPASPPPLPP 120 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +2 Query: 833 PPXSXXPPPPX-PPPXPXXXXXPPXXPXXXP 922 P S PPPP PPP P PP P Sbjct: 103 PSQSPSPPPPASPPPLPPAPSSPPPKKRRLP 133 >01_01_1044 + 8231933-8231941,8232091-8232166,8232423-8232871 Length = 177 Score = 31.9 bits (69), Expect = 0.74 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P P P P P PP Sbjct: 132 PPCPPPCPLPCPPPCPLPCPPPCPP 156 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 859 PXPSPXXXPXPXPPXXPXPXPP 924 P P P P P PP P P PP Sbjct: 131 PPPCPPPCPLPCPPPCPLPCPP 152 >06_03_0743 + 24069752-24070483,24071890-24072345 Length = 395 Score = 25.8 bits (54), Expect(2) = 0.77 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 851 PPPPXPPPXP 880 PPPP PPP P Sbjct: 25 PPPPPPPPPP 34 Score = 24.6 bits (51), Expect(2) = 0.77 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 836 PXSXXPPPPXPPP 874 P PPPP PPP Sbjct: 21 PLHFPPPPPPPPP 33 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 833 PPXSXXPPPPXPP--PXPXXXXXPPXXPXXXPP 925 PP PPPP P P P PP P PP Sbjct: 1146 PPPEKSPPPPAPVILPPPPIKSPPPPAPVISPP 1178 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 833 PPXSXXPPPPXP--PPXPXXXXXPPXXPXXXPP 925 PP PPPP P P P PP P PP Sbjct: 1162 PPPIKSPPPPAPVISPPPPVKSPPPPAPVILPP 1194 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 833 PPXSXXPPPPXP--PPXPXXXXXPPXXPXXXPP 925 PP PPPP P P P PP P PP Sbjct: 1194 PPPVKSPPPPAPVISPPPPVKSPPPPAPVILPP 1226 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPP-PXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP P P P PP P PP Sbjct: 1273 PPPPVKSLPPPAPVSLPPPVVKSLPPPAPVSLPP 1306 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 833 PPXSXXPPPPXPP--PXPXXXXXPPXXPXXXPP 925 PP PPPP P P P PP P PP Sbjct: 1178 PPPVKSPPPPAPVILPPPPVKSPPPPAPVISPP 1210 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 833 PPXSXXPPPPXPP--PXPXXXXXPPXXPXXXPP 925 PP PPPP P P P PP P PP Sbjct: 1210 PPPVKSPPPPAPVILPPPPVKSPPPPAPVISPP 1242 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P S PPP PP P PP P PP Sbjct: 1138 PPVPVSSPPPPEKSPPPPAPVILPP-PPIKSPP 1169 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPP--PXPPPXPXXXXXPPXXPXXXPP 925 P P S PP P PPP P PP PP Sbjct: 1314 PPAPVSLPPPAVKPLPPPVPQVSLPPPKQESLPPP 1348 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP P P P P PP Sbjct: 1153 PPPAPVILPPPPIKSPPPPAPVISPPPPVKSPP 1185 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP P P P P PP Sbjct: 1185 PPPAPVILPPPPVKSPPPPAPVISPPPPVKSPP 1217 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP P P P P PP Sbjct: 1217 PPPAPVILPPPPVKSPPPPAPVISPPPPEKSPP 1249 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP PP P PP PP Sbjct: 1218 PPAPVILPPPPVKSPPPPAPVISPPPPEKSPPP 1250 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP P P P P PP Sbjct: 1169 PPPAPVISPPPPVKSPPPPAPVILPPPPVKSPP 1201 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP PP P PP PP Sbjct: 1170 PPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP 1202 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP PP P PP PP Sbjct: 1186 PPAPVILPPPPVKSPPPPAPVISPPPPVKSPPP 1218 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP P P P P PP Sbjct: 1201 PPPAPVISPPPPVKSPPPPAPVILPPPPVKSPP 1233 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP PP P PP PP Sbjct: 1202 PPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP 1234 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP S P PP PP PP P PP Sbjct: 22 PPSSSSPSPPVPPDPYGADLSPPPPPPPKPP 52 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P P + PPP PPP P PP Sbjct: 34 PDPYGADLSPPPPPPPKPPPTVPPP 58 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 31.5 bits (68), Expect = 0.98 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXP 910 PPPP PPP P PP P Sbjct: 28 PPPPHPPPPPPLEPAPPSTP 47 >10_08_0116 + 14935582-14936089,14936850-14937188,14937914-14937960, 14938175-14938264 Length = 327 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG GG Sbjct: 188 GSGGGGSGGGGGGGGGGGGGGGGGVLAVGG 217 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G GGG GGGG GG G Sbjct: 183 GSSGHGSGGGGSGGGGGGGGGGGGGGGG 210 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 G G GG G GGG GGGG Sbjct: 183 GSSGHGSGGGGSGGGGGGGGGGGGG 207 >09_05_0008 + 20042390-20042845,20043323-20043457,20043539-20043679, 20043771-20043882,20044084-20044154,20044251-20044405, 20044484-20044595,20044932-20045033,20045116-20045176, 20045251-20045422,20045512-20045608,20045692-20045786, 20045881-20046014,20046208-20046422 Length = 685 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG GG G Sbjct: 640 GGSRGGGRFGNRRFSGGGGGRGGGGRGFGGGRG 672 >09_03_0145 - 12749288-12751510 Length = 740 Score = 31.5 bits (68), Expect = 0.98 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P P P PP PPP P PP P Sbjct: 20 PFKPKPTNPSPPPPPPPPGIQPPPPALP 47 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPPP P P PP Sbjct: 33 PPPPPGIQPPPPALPGMPHGRPPPP 57 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PP P P PP Sbjct: 23 PKPTNPSPPPPPPPPGIQPPPPALPGMPHGRPP 55 >07_01_0516 - 3850252-3852870 Length = 872 Score = 31.5 bits (68), Expect = 0.98 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP + P PP PPP P P P Sbjct: 17 PQPPPTSRPLPPPPPPPPPAHGPSPPPP 44 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P L P P P P P PP P PP Sbjct: 10 PPPRLLPPQPPPTSRPLPPPPPPPPPAHGPSPP 42 >06_03_1370 + 29645598-29646288,29646364-29646752 Length = 359 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGG E GG G Sbjct: 8 GGGGGGGGGGGVGGGGGGGRGGERGGGG 35 >06_02_0127 + 12140843-12140966,12141170-12141567 Length = 173 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 90 GGGYGGYGGGYGGGYGGGGGGGGGGG--YGGYG 120 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG G G Sbjct: 138 GGGGGGGYSKGFGGGYGGGGYPGGGYYG 165 >04_03_0709 + 18902507-18902704,18902795-18905028,18905114-18905365, 18905446-18905556,18905646-18905727,18906002-18906193 Length = 1022 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P P P PP P PP Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP PP P PP P PP P P Sbjct: 570 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPP 599 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 31.5 bits (68), Expect = 0.98 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXP 898 PP + PPPP PPP P P Sbjct: 424 PPYAPPPPPPPPPPPPQALPLP 445 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P PPPP PPP P Sbjct: 421 PCGPPYAPPPPPPPPPPP 438 >02_02_0100 - 6783821-6784339,6784815-6784984,6785062-6785164, 6785291-6785454,6786781-6786821,6786933-6787129 Length = 397 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G GGG GGGG GG G Sbjct: 252 GGYRSSYRSGGAAASGGGGGGGGGGSGSSGGYG 284 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXP 910 P S PPPP PPP P P P Sbjct: 113 PQPSPPPPPPPPPPPPTTTTKPESLP 138 Score = 26.6 bits (56), Expect(2) = 1.0 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P P PPPP PPP Sbjct: 113 PQPSPPPPPPPPPPPP 128 Score = 23.4 bits (48), Expect(2) = 1.0 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 854 PPPXPPPXPXXXXXPP 901 PPP PPP P P Sbjct: 150 PPPPPPPPPLLPMAQP 165 >12_02_1114 - 26171876-26172493 Length = 205 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG GG G GGG GGGG GG Sbjct: 57 GGGSGSGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 58 GGSGSGGGGGGG---GGGGGGGGGGGGGGGGGG 87 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GGG GGGG GG G Sbjct: 57 GGGSGSGGGGGGGGGGGGGGGGGGG 81 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G GGG GGGG GG G Sbjct: 57 GGGSGSGGGGGGGGGGGGGGGGGGGGGG 84 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXE 841 GG G GG G GGG GGG E Sbjct: 64 GGGGGGGGGGGGGGGGGGGGGGGGSWRE 91 >12_02_0450 + 19172812-19172920,19173020-19173088,19173168-19173274, 19173874-19174365 Length = 258 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXG-GXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G G GGG GGGG GG G Sbjct: 112 GGFRSGGGGYGGGGYGGGGGGYGGGGYSGGGGYG 145 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGG--GGXXEXGGXG 826 GG G GG G GGG GG GG GG G Sbjct: 146 GGGYSGGGGGGGGYQGGGGGYGGNNGGYGNRGGGG 180 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGX--GGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 122 GGGGYGGGGGGYGGGGYSGGGGYGGGGYSGGGGGG 156 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGGG + GG G Sbjct: 135 GGGYSG--GGGYGGGGYSGGGGGGGGYQGGGGG 165 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P S PPPP PPP P Sbjct: 151 PPPQESTPPPPPPPPPAP 168 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P PP PPPP PPP Sbjct: 150 PPPPQESTPPPPPPPP 165 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPP PPP P Sbjct: 149 PPPPPQESTPPPPPPPPP 166 >10_07_0161 - 13674631-13675433,13675793-13675862 Length = 290 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GG GGGG GG Sbjct: 193 GGNGGGGSGGGGGARGSSGGGGGGGWAGGGG 223 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GGG GGG G G Sbjct: 179 GGLTDSGGGGGWTGGGNGGGGSGGGGGARGSSG 211 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP + P PP PPP P P PP Sbjct: 323 PPSNPPPAPPPPPPPPSRFNNTTPKPPPPPP 353 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP + PPPP PPP P P PP Sbjct: 327 PPPA--PPPPPPPPSRFNNTTPKPPPPPPPP 355 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPPP PPP P PP Sbjct: 1155 PLPPP---PPPPLPPPPPVAPFHPP 1176 >06_02_0126 + 12130409-12130532,12131015-12131373 Length = 160 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 90 GGGYGGYGGGYGG--GYGGGGGGGGYGGYGGYG 120 >03_05_0704 - 26953474-26953643,26953770-26953801,26953915-26954009, 26954107-26954180,26954283-26954412,26954522-26954585, 26954660-26954722,26954795-26954937,26955386-26955523, 26955610-26955731,26955805-26955976,26956559-26956630, 26956753-26956887,26956987-26957103,26957184-26957316, 26957455-26957561,26958060-26958077,26958235-26958379, 26958472-26958671,26960744-26961421 Length = 935 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 GG G GG G GGG GGGG G Sbjct: 8 GGGRRGGRGGGGGREGGGGGGGGGGRGGQG 37 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG + G Sbjct: 9 GGRRGGRGGGGGREGGGGGGGGGGRGGQGRG 39 >02_05_0149 + 26290236-26290880 Length = 214 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 120 GGGYGGHPGGFGG--GGGGGGGGGGRNYGGGSG 150 >02_03_0120 + 15463163-15465250 Length = 695 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P S PPPP PPP P Sbjct: 302 PPPSPSPSPPPPSPPPPP 319 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXP 915 P L PP P PSP P P PP P P Sbjct: 295 PNNQPLPPPPSPSPSP---PPPSPPPPPHP 321 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +2 Query: 827 PXPPXS-XXPPPPXPPPXPXXXXXPP 901 P PP + PPPP P P P PP Sbjct: 292 PMPPNNQPLPPPPSPSPSPPPPSPPP 317 >01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 Length = 448 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGGG G G Sbjct: 282 GGKGGGGGGGGNTGGGIGGSTGGGGRGAGAGVG 314 >01_06_0561 + 30251547-30252173,30252248-30252405,30253250-30254192, 30254271-30254438,30254546-30254857,30255498-30255557, 30255905-30255937,30256083-30256271 Length = 829 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG--XXEXGG 832 GG G GG G GGG GGGG E GG Sbjct: 21 GGRRGGGGGGGGGGGGTGGGGGGGGRRGGEDGG 53 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G GGG GGGG GG G Sbjct: 11 GGRRWGEGEEGGRRGGGGGGGGGGGGTGGGGGG 43 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGG GG G Sbjct: 18 GEEGGRRGGGGGGGGGGGGTGGGGGGGG 45 >01_02_0007 + 10132380-10133201 Length = 273 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P L P P P P P P P P P P P Sbjct: 56 PQPQPLPQPNPNPQPQPLPQPQPQPQPQPQPLP 88 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P L P P P P P P P P P P P Sbjct: 68 PQPQPLPQPQPQPQPQPQPLPQPQPQPQPLPLP 100 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P L P P P P P P P P P P P Sbjct: 92 PQPQPLPLPGPQPLPQPGPQPNPNPQPLPQPNP 124 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P L P P P P+P P P P P P P Sbjct: 100 PGPQPLPQPGPQPNPNPQPLPQPNPNPQPLPQP 132 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +1 Query: 826 PXPXXLXXP---PXPXPSPXXXPXPXPPXXPXPXP 921 P P L P P P P P P P P P P P Sbjct: 94 PQPLPLPGPQPLPQPGPQPNPNPQPLPQPNPNPQP 128 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 52 PNPRPQPQPLPQPNPNPQPQPLPQPQPQPQPQP 84 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 54 PRPQPQPLPQPNPNPQPQPLPQPQPQPQPQPQP 86 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 64 PNPNPQPQPLPQPQPQPQPQPQPLPQPQPQPQP 96 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 66 PNPQPQPLPQPQPQPQPQPQPLPQPQPQPQPLP 98 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 78 PQPQPQPQPLPQPQPQPQPLPLPGPQPLPQPGP 110 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 86 PLPQPQPQPQPLPLPGPQPLPQPGPQPNPNPQP 118 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 98 PLPGPQPLPQPGPQPNPNPQPLPQPNPNPQPLP 130 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 112 PNPNPQPLPQPNPNPQPLPQPDPNAPPLPLPQP 144 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 60 PLPQPNPNPQPQPLPQPQPQPQPQPQPLPQPQP 92 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 110 PQPNPNPQPLPQPNPNPQPLPQPDPNAPPLPLP 142 >01_01_1108 + 8758486-8758815,8758913-8758960,8761512-8761664, 8761749-8761847,8761884-8761991,8762078-8762200, 8763030-8763287 Length = 372 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GG GGGG GG Sbjct: 3 GGGGGGGGGGVMAGPGVAGGGGGGGGGGVGG 33 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPX-PXXXXXPPXXPXXXPP 925 P P PPP PPP P PP P PP Sbjct: 94 PVTPPPVTPPPVTPPPVSPPPATPPPALPPSTPP 127 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP PP P P P PP Sbjct: 109 PVSPPPATPPPALPPSTPPPVAAPAEAPAALPP 141 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PPP PP P PP Sbjct: 91 PPPPVTPPPVTPPPVTPPPVSPP--PATPPP 119 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP PPP PP P PP Sbjct: 84 PPTPKKAPPPPVTPPPVTPPPVTPP--PVSPPP 114 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 851 PPPPXPPPXP 880 PPPP PPP P Sbjct: 103 PPPPPPPPSP 112 Score = 25.8 bits (54), Expect(2) = 1.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 851 PPPPXPPPXP 880 PPPP PPP P Sbjct: 171 PPPPPPPPSP 180 Score = 23.8 bits (49), Expect(2) = 1.3 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P P + PPP PPP Sbjct: 58 PNPVHNEFQPPPPPPP 73 Score = 23.4 bits (48), Expect(2) = 1.8 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P P + PPP PPP Sbjct: 162 PDPIHNEFQPPPPPPP 177 >12_01_1043 + 10731454-10732131 Length = 225 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXP 880 PP + PPPP PPP P Sbjct: 43 PPPASVPPPPPPPPAP 58 >10_08_0553 - 18720436-18720494,18721102-18721106,18721136-18721257, 18721390-18721478,18722136-18722316,18722403-18722654, 18722755-18722993,18723680-18723914,18724072-18724132, 18724632-18724987 Length = 532 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGGG G G Sbjct: 15 GGGGGGGGGGGGGRGNGGGGFGGGGGGGGGNHG 47 >10_08_0521 + 18500105-18500529,18501216-18501284,18501467-18501555, 18501726-18501838,18502023-18502124,18502576-18502663, 18502795-18503361,18503766-18504149,18504168-18504384, 18504466-18504548,18505174-18505256,18505796-18506032, 18506481-18506658,18506814-18507328,18507740-18507916, 18508385-18508768,18508885-18509031 Length = 1285 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG G GG GG G Sbjct: 77 GGAGGGGGGVGDVEGGGGGGGAGGGGGGGGGG 108 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -2 Query: 924 GGXXXGXXG-GXXXXXGXGGGXGGGGXXEXGG 832 GG G G G G GGG GGGG GG Sbjct: 77 GGAGGGGGGVGDVEGGGGGGGAGGGGGGGGGG 108 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPX-PPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P PP Sbjct: 59 PPPPAPLTPPPPKSPPPPPHIQTTDLPPPKPLPP 92 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/27 (44%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +2 Query: 827 PXPPXSXXPPPPXP--PPXPXXXXXPP 901 P P + PPPP P PP P PP Sbjct: 51 PDAPAAAAPPPPAPLTPPPPKSPPPPP 77 >08_02_0602 + 19183549-19184919 Length = 456 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 GG G GG G GGG GGGG Sbjct: 56 GGSHRGASGGGSGGGGGGGGGGGGG 80 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G G G GGGG GG G Sbjct: 50 GSGSGSGGSHRGASGGGSGGGGGGGGGGGGGG 81 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 853 PXPXPSPXXXPXPXPPXXPXPXPP 924 P P P+P P P PP P PP Sbjct: 589 PSPPPAPKAAPPPPPPKSTGPGPP 612 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P L P P P P PP P P P Sbjct: 562 PIPKLLSPPAPQAPMPPLKASPVPPPEPSPPP 593 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +2 Query: 827 PXPPX--SXXPPP-PXPPPXPXXXXXPPXXPXXXP 922 P PP S PPP P PPP P PP P Sbjct: 575 PMPPLKASPVPPPEPSPPPAPKAAPPPPPPKSTGP 609 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P PP S P PP PPP Sbjct: 601 PPPPKSTGPGPPRPPP 616 >07_03_0594 - 19833967-19834557 Length = 196 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 897 GXXXXXGXGGGXGGGGXXEXGGXG 826 G G GGG GGGG E GG G Sbjct: 64 GGADHRGGGGGGGGGGGLEIGGGG 87 >07_01_0479 + 3606663-3607448 Length = 261 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP PPP PP P PP P P Sbjct: 169 PPPGQMPPPMRPPQMPIPFQRPPGVPPAFP 198 >06_02_0122 - 12095385-12095713,12096018-12096120 Length = 143 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 GG G GG G GGG GGGG Sbjct: 117 GGYGGGYGGGYGGGGGYGGGYGGGG 141 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG 853 GG G GG G GGG GGG Sbjct: 113 GGYGGGYGGGYGGGYGGGGGYGGG 136 >05_06_0078 - 25412770-25413852 Length = 360 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GG G GG G Sbjct: 292 GGEGGGAAGGGRDGITGGGGGGGSGAPRDGGNG 324 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXP 880 PP + PPPP PPP P Sbjct: 4 PPAATAPPPPPPPPPP 19 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P P PP PPP P PP P PP Sbjct: 39 PPPARHRAPSPPRPPPPP----PPPTQPAPPPP 67 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +2 Query: 827 PXPPX---SXXPPPPXPPPXPXXXXXPPXXP 910 P PP + PP P PPP P PP P Sbjct: 38 PPPPARHRAPSPPRPPPPPPPPTQPAPPPPP 68 >03_05_0630 + 26260159-26260272,26260520-26260894 Length = 162 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 90 GGGGGGYGGGGG---GYGGGRGGGGYGGGGGGG 119 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 97 GGGGGGYGGGRGGGGYGGGGGGGYGRREGGYG 128 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GGG GGGG G G Sbjct: 117 GGGYGRREGGYGGGGGYGGGRGGGGGGYGGSRG 149 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG GG G Sbjct: 113 GGGGGGGYGRREGGYGGGGGYGGGRGGGGGGYG 145 >03_02_0738 - 10824121-10825572 Length = 483 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP S PP PPP P PP Sbjct: 81 PSPPSSSPPPLSFPPPPPPPSSPPP 105 >02_03_0388 + 18429538-18430598,18430971-18431081,18431165-18431237, 18431513-18431695 Length = 475 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P PSP P PP P P PP Sbjct: 77 PPAP-PSPPQASAPSPPHAPAPSPP 100 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PSP P PP P P PP Sbjct: 92 PHAPAPSPPQAPAMTPPQAPAPTPP 116 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 826 PXPXXLXXPPXPX-PSPXXXPXPXPPXXPXPXPP 924 P P PP PSP P P PP P PP Sbjct: 75 PSPPAPPSPPQASAPSPPHAPAPSPPQAPAMTPP 108 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG GGG GGGG + GG G Sbjct: 101 GGGSSTGGGGIYYPPPTGGGGGGGGGWQQGGGG 133 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G GGG GGGG + GG G Sbjct: 102 GGSSTGGGGIYYPPPTGGGGGGGGGWQQGGGGG 134 >10_08_0214 - 15915156-15915713 Length = 185 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 879 GXGGGXGGGGXXEXGGXG 826 G GGG GGGG E GG G Sbjct: 30 GPGGGGGGGGGGEGGGGG 47 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG E GG G Sbjct: 60 GEGGGSGGAAGGGYGRGGG-GGGGGGEGGGSG 90 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG + GG G Sbjct: 137 GYGSGAGGAHGGGYGSGGG-GGGGGGQGGGSG 167 >10_08_0213 - 15912048-15912716 Length = 222 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG G GG GG G Sbjct: 48 GGGYGGSGYGSGSGYGEGGGAGAGGYGHGGGGG 80 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG GG G Sbjct: 162 GGYGSGSGYGSGRGYGQGGGAYGGGYASGGGGG 194 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G G G GGG GGGG GG Sbjct: 133 GYGSGYGSGAGGASGGGGGHGGGGGGGQGG 162 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG GG GGGG + GG G Sbjct: 173 GRGYGQGGGAYGGGYASGGGGGGGGGQGGGSG 204 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG G G Sbjct: 139 GSGAGGASGGGGGHGGGGGGGQGGGYGSGSGYG 171 >10_08_0146 - 15184123-15184968,15185049-15185519,15185606-15185869 Length = 526 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXP 915 P P L PP P+P P P P P P Sbjct: 8 PTPLLLPPPPPQEPAPLSPPPPLPTPKPIP 37 >07_03_0154 + 14509979-14512033 Length = 684 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 859 PXPSPXXXPXPXPPXXPXPXPP 924 P P P P P PP P P PP Sbjct: 45 PLPLPAAAPPPPPPPPPPPPPP 66 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P + PPPP PPP P Sbjct: 47 PLPAAAPPPPPPPPPPPP 64 Score = 29.1 bits (62), Expect = 5.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P + PPPP PPP P Sbjct: 45 PLPLPAAAPPPPPPPPPP 62 >07_03_0089 - 13300902-13301645 Length = 247 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P PSP P P P P P P Sbjct: 152 PQPDPKQDPQPNPQPSPKADPKPNPKPKPQPEP 184 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P PSP P P P P P P Sbjct: 186 PNPKPEPKPEPKPEPSPNPKPNPNPKPEPQPDP 218 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 52 PQPETKPSPQPNPQPNPQPDPKPSPQPDPKPTP 84 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 120 PQPNPQPDPKPTPQPNPKQDPQPNPQPDPKPTP 152 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 172 PKPNPKPKPQPEPSPNPKPEPKPEPKPEPSPNP 204 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 188 PKPEPKPEPKPEPSPNPKPNPNPKPEPQPDPKP 220 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 192 PKPEPKPEPSPNPKPNPNPKPEPQPDPKPEPKP 224 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 64 PQPNPQPDPKPSPQPDPKPTPQPEPKQDPKPNP 96 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 72 PKPSPQPDPKPTPQPEPKQDPKPNPQPDPKPSP 104 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 84 PQPEPKQDPKPNPQPDPKPSPQPDPKPTPQPDP 116 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 92 PKPNPQPDPKPSPQPDPKPTPQPDPKQDPQPNP 124 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 100 PKPSPQPDPKPTPQPDPKQDPQPNPQPDPKPTP 132 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 132 PQPNPKQDPQPNPQPDPKPTPQPDPKQDPQPNP 164 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 174 PNPKPKPQPEPSPNPKPEPKPEPKPEPSPNPKP 206 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 194 PEPKPEPSPNPKPNPNPKPEPQPDPKPEPKPQP 226 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 196 PKPEPSPNPKPNPNPKPEPQPDPKPEPKPQPEP 228 >07_01_0862 - 7172083-7172931 Length = 282 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP--XXXXXPPXXPXXXPP 925 P PP PPP PPP P P P PP Sbjct: 175 PLPPKKKPLPPPSPPPQPPLPEKENTPLPPLLLPP 209 >06_03_1153 - 28047125-28047751 Length = 208 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPX-PPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP PP Sbjct: 9 PPPPAIFCPPPLSPPPPPPPIFYSPPDVSYFSPP 42 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PP PP P P Sbjct: 77 PPPPPPPPPPPSPPATHDVGQPPPPPSLAAP 107 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PP PP PP Sbjct: 78 PPPPPPPPPPSPPATHDVGQPPPPPSLAAPP 108 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPP 901 PP PPPP PPP P P Sbjct: 305 PPIPPPPPPPPPPPMPRSRSASP 327 >04_04_1414 - 33394518-33394847 Length = 109 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GGG GGGG GG G Sbjct: 84 GGPACGGGGGGGGGGGGCGGGGGGG 108 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG GG G Sbjct: 75 GAVCGGSACGGPACGGGGGGGGGGGGCGGGGGG 107 >04_04_1070 + 30579263-30579861,30579970-30580095,30580190-30580394 Length = 309 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P P + PPPP PPP P P Sbjct: 93 PAAPVAAAPPPPPPPPAPVAAALAP 117 >03_06_0365 - 33399422-33399925,33400470-33400583,33400762-33400929, 33401305-33401547,33402148-33402231,33402323-33403098, 33404423-33404636 Length = 700 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GGG GGGG GG G Sbjct: 662 GGGGGYGGGGGGYGGGGYGGGGGYG 686 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+P P P P P PP Sbjct: 172 PPPPPPAPEPEPEPPKKEEPQPPPP 196 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P P PP P PP Sbjct: 171 PPPPPPPAPEPEPEPPKKEEPQPP 194 >03_05_0843 + 28126480-28127007,28127092-28127457,28129388-28129487, 28130266-28130546,28130643-28130705,28131276-28131431, 28131913-28132080,28132158-28132298,28132714-28132840, 28132888-28132994,28134142-28134372,28134446-28134559, 28135091-28135261 Length = 850 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPP 901 P PPPP PPP P PP Sbjct: 34 PAVMPPPPPPLPPPPPRSNSAPP 56 >03_05_0690 + 26778567-26778804,26778950-26779024,26779995-26780099, 26780869-26781000,26781432-26781571,26782213-26782323, 26782690-26782812,26784166-26784267,26784536-26784546, 26784878-26785103,26785363-26785401,26785413-26785583, 26785674-26785753,26785976-26786039 Length = 538 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGG-XXEXGGXG 826 G G GG G GGG GGGG + GG G Sbjct: 7 GRHRGRGGGGGGGGGGGGGGGGGGVGGDRGGGG 39 >03_03_0106 - 14500935-14501263,14501357-14501432,14501531-14501542 Length = 138 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXP 880 PP PPPP PPP P Sbjct: 85 PPKKPDPPPPCPPPPP 100 >03_02_0786 - 11169820-11170158,11170245-11170433,11171173-11171469, 11171568-11171630,11171884-11171997,11173011-11173091, 11173176-11173307,11174265-11174363,11174453-11174530, 11174641-11174901 Length = 550 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP-PXPXXXXXPPXXP 910 P PP PPPP PP P PP P Sbjct: 30 PPPPMGPPPPPPMPPVPVMYLRGVPPPPP 58 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/63 (28%), Positives = 18/63 (28%), Gaps = 2/63 (3%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPS--PXXXPXPXPPXXPXP 915 PP P PP P P PS P P P PP P P Sbjct: 46 PPSQPPPPQAMYQAHPQYPMPGSLPPPPPRPPSFAPENALPPSSPPPPSPPPPPPSSPPP 105 Query: 916 XPP 924 PP Sbjct: 106 VPP 108 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P S PPPP PP PP P P Sbjct: 66 PGSLPPPPPRPPSFAPENALPPSSPPPPSP 95 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P S PPP PPP P P P P Sbjct: 86 PPSSPPPPSPPPPPPSSPPPVPPSPTAAP 114 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPP PPP P P Sbjct: 90 PPPPSPPPPPPSSPPPVPPSPTAAP 114 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPP 901 PP S PP P PPP PP Sbjct: 86 PPSSPPPPSPPPPPPSSPPPVPP 108 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPP P P PP P P Sbjct: 430 PPPPPEHPPPPESTSPPPPPTSDPPPVPPPPP 461 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PPPP PP P PP PP Sbjct: 423 PSDAFEQPPPPPEHPPPPESTSPPPPPTSDPPP 455 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PPP P P P Sbjct: 446 PPPPTSDPPPVPPPPPTTGSFMPIPSAPFAGLP 478 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP-PXPXXXXXPPXXPXXXPP 925 P P + PPP P P P PP P PP Sbjct: 421 PLPSDAFEQPPPPPEHPPPPESTSPPPPPTSDPP 454 >01_06_1596 - 38514278-38514346,38514547-38514705,38514776-38514898, 38514985-38515047,38515248-38515352,38515487-38515586, 38515716-38515786,38516329-38516385,38516830-38516907, 38516975-38517049,38517180-38517230,38517453-38517466, 38517516-38517616,38517703-38517764,38518346-38518372, 38518901-38519581 Length = 611 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPP 901 PP PPP PPP P PP Sbjct: 134 PPDDFPMPPPPPPPLPPMQHVPP 156 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 865 PSPXXXPXPXPPXXPXPXPP 924 PSP P P PP P P PP Sbjct: 74 PSPPPPPPPPPPPPPVPVPP 93 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPP 901 PPPP PPP P PP Sbjct: 77 PPPPPPPPPPPPVPVPP 93 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPP 901 PP PPPP PPP PP Sbjct: 76 PPTPPSPPPPPPPPPTNGTLTPP 98 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P P PPPP PPP PP Sbjct: 75 PPPTPPSPPPPPPPPPTNGTLTPPP 99 >02_01_0158 - 1103461-1104186 Length = 241 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGGG G G Sbjct: 80 GGAGGGGGGGGGFGSRGGGGSGGGGRSYGGSWG 112 Score = 23.4 bits (48), Expect(3) = 2.3 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 873 GGGXGGGGXXEXGG 832 GGG GGGG GG Sbjct: 209 GGGGGGGGRFGGGG 222 Score = 22.6 bits (46), Expect(3) = 2.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 879 GXGGGXGGGG 850 G GGG GGGG Sbjct: 182 GGGGGGGGGG 191 Score = 21.0 bits (42), Expect(3) = 2.3 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGG 853 G G G GGG GGG Sbjct: 142 GGGVGVGGGGGGGGGAGGG 160 >12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388, 7848486-7848738 Length = 240 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GG + GG G Sbjct: 159 GGNGSGYGSGYGSGYGQGGGVCGGSYGQGGGGG 191 Score = 25.8 bits (54), Expect(2) = 3.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG 853 G G GG G GGG GGG Sbjct: 174 GQGGGVCGGSYGQGGGGGGGGGG 196 Score = 22.6 bits (46), Expect(2) = 3.0 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 Query: 879 GXGGGXGGGGXXEXGGXG 826 G GGG GGG G G Sbjct: 212 GGGGGGQGGGSSSGSGYG 229 >12_02_0370 + 18139557-18140469,18140561-18140704,18140804-18140956, 18141032-18141147,18141231-18141398,18142110-18142334, 18142458-18142577 Length = 612 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 5/38 (13%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXP-----XPXPPXXPXPXPP 924 P P + PP P P P P P P P P PP Sbjct: 62 PVPVVISEPPPPQPQPEPQPAAPSQPPPPQEQPSPPPP 99 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXP 880 PP PPPP PPP P Sbjct: 84 PPSPPPPPPPPPPPRP 99 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 833 PPXSXXPPPPXPPP 874 PP S PPPP PPP Sbjct: 83 PPPSPPPPPPPPPP 96 >11_01_0621 - 4981070-4981136,4982906-4983825 Length = 328 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P PP PPPP PPP Sbjct: 129 PPPPHPLPPPPPTPPP 144 Score = 29.1 bits (62), Expect = 5.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PP P Sbjct: 128 PPPPPHPLPPPPPTPPPP 145 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P PP PPPP PPP Sbjct: 12 PAPPPPPPPPPPPPPP 27 >08_01_0134 + 1067826-1068158 Length = 110 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P P S PPPP P P P PP Sbjct: 2 PPPLPSSRPPPPPPLPRPHPAPPPP 26 >07_03_1710 - 28903614-28903673,28904982-28905146,28905453-28905638, 28905784-28905927,28906281-28906460,28906559-28907215 Length = 463 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P P S PPP PPP P P P Sbjct: 56 PPPKPSPTPPPASPPPAPTPPQTRPPSP 83 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG GGG GGGG GG G Sbjct: 183 GRAPGGGGGGGGPGRAPGGGGGGGGLGGGGGEG 215 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G G G GG GGGG E G Sbjct: 300 GGGGGGGGGHGAPELGFSGGGGGGGGGEIAG 330 Score = 23.8 bits (49), Expect(2) = 8.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 GG G G GGG GGGG Sbjct: 337 GGGGAGGVFPPTPDLGGGGGGGGGG 361 Score = 23.0 bits (47), Expect(2) = 8.0 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 873 GGGXGGGGXXEXGGXG 826 GGG GG G GG G Sbjct: 391 GGGGGGSGGGGGGGGG 406 >07_03_0091 + 13312904-13313647 Length = 247 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P PSP P P P P P P Sbjct: 186 PNPKPEPKPEPKPEPSPNPKPNPNPKPEPQPDP 218 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 52 PQPETKPSPQPNPQPNPQPDPKPSPQPDPKPTP 84 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 853 PXPXPSPXXXPXPXPPXXPXPXP 921 P P PSP P P P P P P Sbjct: 162 PNPQPSPKADPKPNPKPKPQPEP 184 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 172 PKPNPKPKPQPEPSPNPKPEPKPEPKPEPSPNP 204 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 188 PKPEPKPEPKPEPSPNPKPNPNPKPEPQPDPKP 220 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 192 PKPEPKPEPSPNPKPNPNPKPEPQPDPKPEPKP 224 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 64 PQPNPQPDPKPSPQPDPKPTPQPEPKQDPQPNP 96 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 84 PQPEPKQDPQPNPQPDPKQSPQPDPKPTPQPNP 116 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 174 PNPKPKPQPEPSPNPKPEPKPEPKPEPSPNPKP 206 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 194 PEPKPEPSPNPKPNPNPKPEPQPDPKPEPKPQP 226 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 196 PKPEPSPNPKPNPNPKPEPQPDPKPEPKPQPEP 228 >07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991, 6152778-6153801 Length = 737 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXP 880 PP PPPP PPP P Sbjct: 98 PPPPELPPPPPPPPLP 113 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PP P Sbjct: 97 PPPPPELPPPPPPPPLPP 114 >06_01_1113 - 9164953-9165044,9166453-9166586,9166624-9166734, 9166815-9167066,9167152-9168186,9168313-9169187, 9169476-9169673 Length = 898 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P P P PP P P Sbjct: 460 PAPPSPPEPPSPRDPASPPSLRSPPRQPTPPP 491 >06_01_0194 + 1503350-1503554,1504399-1504490,1504835-1504935, 1506186-1506276,1506616-1506674,1506764-1506884, 1506959-1507027,1507321-1507373,1507688-1507796, 1507895-1508065,1508148-1508306,1508561-1508650, 1508751-1508933,1509837-1510027,1510340-1510787 Length = 713 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG G G Sbjct: 670 GRGRGGGGGRGRGGGGGGGRGGGGGGGGGRGG 701 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 675 GGGGRGRGGGGGGGRGGGGGGGGGRGGRGRGRG 707 >05_06_0026 - 25024807-25025300,25025432-25025495,25025567-25025662, 25025719-25025929,25026616-25026690,25026820-25027037 Length = 385 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +2 Query: 836 PXSXXPPPP---XPPPXPXXXXXPPXXPXXXPP 925 P S PP P PPP P PP P PP Sbjct: 5 PISVKPPSPVAAAPPPPPVQVPVPPPPPPPLPP 37 Score = 29.1 bits (62), Expect = 5.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPP PPP P Sbjct: 19 PPPPVQVPVPPPPPPPLP 36 >05_04_0206 + 19034259-19035462,19036870-19037045,19037752-19037975, 19038133-19038914,19039337-19039494 Length = 847 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P + PPPP PPP P Sbjct: 210 PGTPVTPQPPPPPPPPPP 227 >05_03_0040 - 7646525-7647775 Length = 416 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P + P P P P P P P P P P P Sbjct: 78 PEPKPVPEPEPKPEPKPEPKPEPKPEPKPYPEP 110 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P+P P P P P P P Sbjct: 54 PEPEPKPKPKPHPKPTPKPEPKPEPEPKPVPEP 86 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 64 PHPKPTPKPEPKPEPEPKPVPEPEPKPEPKPEP 96 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 102 PEPKPYPEPKPEPKPEPKPEPEPKPEPKPEPKP 134 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 134 PEPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKP 166 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 234 PEPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKP 266 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 326 PEPKPYPEPKPDPKPEPKPHPEPKPEPKPQPEP 358 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 56 PEPKPKPKPHPKPTPKPEPKPEPEPKPVPEPEP 88 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 62 PKPHPKPTPKPEPKPEPEPKPVPEPEPKPEPKP 94 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 66 PKPTPKPEPKPEPEPKPVPEPEPKPEPKPEPKP 98 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 70 PKPEPKPEPEPKPVPEPEPKPEPKPEPKPEPKP 102 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 76 PEPEPKPVPEPEPKPEPKPEPKPEPKPEPKPYP 108 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 84 PEPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKP 116 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 88 PKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKP 120 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 96 PKPEPKPEPKPYPEPKPEPKPEPKPEPEPKPEP 128 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 100 PKPEPKPYPEPKPEPKPEPKPEPEPKPEPKPEP 132 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 106 PYPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKP 138 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 110 PKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEP 142 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 120 PEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKP 152 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 128 PKPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKP 160 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 132 PKPEPKPYPEPKPEPKPEPKPEPKPEPKPKPEP 164 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 138 PYPEPKPEPKPEPKPEPKPEPKPKPEPKPHPEP 170 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 146 PKPEPKPEPKPEPKPKPEPKPHPEPKPDPKPEP 178 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 150 PKPEPKPEPKPKPEPKPHPEPKPDPKPEPKPHP 182 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 154 PKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEP 186 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 160 PKPEPKPHPEPKPDPKPEPKPHPEPEPKPEPKP 192 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 170 PKPDPKPEPKPHPEPEPKPEPKPEPKPHPEPEP 202 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 174 PKPEPKPHPEPEPKPEPKPEPKPHPEPEPKPEP 206 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 186 PKPEPKPEPKPHPEPEPKPEPKPEPKPEPKPEP 218 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 190 PKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEP 222 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 198 PEPEPKPEPKPEPKPEPKPEPKPEPKPKPKPEP 230 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 202 PKPEPKPEPKPEPKPEPKPEPKPKPKPEPKPKP 234 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 206 PKPEPKPEPKPEPKPEPKPKPKPEPKPKPEPKP 238 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 210 PKPEPKPEPKPEPKPKPKPEPKPKPEPKPYPEP 242 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 218 PKPEPKPKPKPEPKPKPEPKPYPEPKPKPEPKP 250 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 220 PEPKPKPKPEPKPKPEPKPYPEPKPKPEPKPEP 252 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 222 PKPKPKPEPKPKPEPKPYPEPKPKPEPKPEPKP 254 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 226 PKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPKP 258 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 228 PEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEP 260 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 232 PKPEPKPYPEPKPKPEPKPEPKPEPKPEPKPEP 264 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 238 PYPEPKPKPEPKPEPKPEPKPEPKPEPKPEPKP 270 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 240 PEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEP 272 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 244 PKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP 276 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 248 PKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKP 280 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 252 PKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKP 284 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 256 PKPEPKPEPKPEPKPEPKPEPKPKPEPKPHPKP 288 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 264 PKPEPKPEPKPEPKPKPEPKPHPKPEPKPEPKP 296 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 268 PKPEPKPEPKPKPEPKPHPKPEPKPEPKPEPKP 300 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 272 PKPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKP 304 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 274 PEPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEP 306 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 278 PKPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEP 310 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 282 PKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEP 314 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 286 PKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKP 318 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 290 PKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKP 322 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 294 PKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKP 326 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 298 PKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKP 330 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 302 PKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEP 334 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 312 PEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKP 344 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 324 PKPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQP 356 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 334 PKPDPKPEPKPHPEPKPEPKPQPEPKPEPKPEP 366 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 338 PKPEPKPHPEPKPEPKPQPEPKPEPKPEPKPEP 370 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 344 PHPEPKPEPKPQPEPKPEPKPEPKPEPKPEPKP 376 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 348 PKPEPKPQPEPKPEPKPEPKPEPKPEPKPEPKP 380 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 350 PEPKPQPEPKPEPKPEPKPEPKPEPKPEPKPYP 382 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 354 PQPEPKPEPKPEPKPEPKPEPKPEPKPYPEPKP 386 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 358 PKPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKP 390 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 362 PKPEPKPEPKPEPKPEPKPYPEPKPEPKPKPKP 394 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 60 PKPKPHPKPTPKPEPKPEPEPKPVPEPEPKPEP 92 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 72 PEPKPEPEPKPVPEPEPKPEPKPEPKPEPKPEP 104 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 74 PKPEPEPKPVPEPEPKPEPKPEPKPEPKPEPKP 106 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 80 PKPVPEPEPKPEPKPEPKPEPKPEPKPYPEPKP 112 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 86 PEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEP 118 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 90 PEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEP 122 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 94 PEPKPEPKPEPKPYPEPKPEPKPEPKPEPEPKP 126 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 98 PEPKPEPKPYPEPKPEPKPEPKPEPEPKPEPKP 130 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 104 PKPYPEPKPEPKPEPKPEPEPKPEPKPEPKPEP 136 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 108 PEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYP 140 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 112 PEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKP 144 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 116 PEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKP 148 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 118 PKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEP 150 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 122 PEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEP 154 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 126 PEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEP 158 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 130 PEPKPEPKPYPEPKPEPKPEPKPEPKPEPKPKP 162 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 136 PKPYPEPKPEPKPEPKPEPKPEPKPKPEPKPHP 168 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 140 PEPKPEPKPEPKPEPKPEPKPKPEPKPHPEPKP 172 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 144 PEPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKP 176 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 148 PEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKP 180 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 158 PKPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEP 190 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 162 PEPKPHPEPKPDPKPEPKPHPEPEPKPEPKPEP 194 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 164 PKPHPEPKPDPKPEPKPHPEPEPKPEPKPEPKP 196 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 176 PEPKPHPEPEPKPEPKPEPKPHPEPEPKPEPKP 208 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 178 PKPHPEPEPKPEPKPEPKPHPEPEPKPEPKPEP 210 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 180 PHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKP 212 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 184 PEPKPEPKPEPKPHPEPEPKPEPKPEPKPEPKP 216 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 188 PEPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKP 220 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 192 PEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKP 224 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 194 PKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPKP 226 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 196 PHPEPEPKPEPKPEPKPEPKPEPKPEPKPKPKP 228 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 200 PEPKPEPKPEPKPEPKPEPKPEPKPKPKPEPKP 232 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 204 PEPKPEPKPEPKPEPKPEPKPKPKPEPKPKPEP 236 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 208 PEPKPEPKPEPKPEPKPKPKPEPKPKPEPKPYP 240 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 212 PEPKPEPKPEPKPKPKPEPKPKPEPKPYPEPKP 244 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 216 PEPKPEPKPKPKPEPKPKPEPKPYPEPKPKPEP 248 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 230 PKPKPEPKPYPEPKPKPEPKPEPKPEPKPEPKP 262 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 236 PKPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEP 268 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 242 PKPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKP 274 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 246 PEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKP 278 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 250 PEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEP 282 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 254 PEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPHP 286 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 258 PEPKPEPKPEPKPEPKPEPKPKPEPKPHPKPEP 290 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 262 PEPKPEPKPEPKPEPKPKPEPKPHPKPEPKPEP 294 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 266 PEPKPEPKPEPKPKPEPKPHPKPEPKPEPKPEP 298 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 276 PKPKPEPKPHPKPEPKPEPKPEPKPEPKPEPKP 308 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 280 PEPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKP 312 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 284 PHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEP 316 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 288 PEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEP 320 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 292 PEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEP 324 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 296 PEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEP 328 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 300 PEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYP 332 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 304 PEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKP 336 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 308 PEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKP 340 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 310 PKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEP 342 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 314 PEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHP 346 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 318 PEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKP 350 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 322 PEPKPEPKPYPEPKPDPKPEPKPHPEPKPEPKP 354 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 328 PKPYPEPKPDPKPEPKPHPEPKPEPKPQPEPKP 360 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 336 PDPKPEPKPHPEPKPEPKPQPEPKPEPKPEPKP 368 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 340 PEPKPHPEPKPEPKPQPEPKPEPKPEPKPEPKP 372 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 342 PKPHPEPKPEPKPQPEPKPEPKPEPKPEPKPEP 374 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 346 PEPKPEPKPQPEPKPEPKPEPKPEPKPEPKPEP 378 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 352 PKPQPEPKPEPKPEPKPEPKPEPKPEPKPYPEP 384 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 360 PEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPKP 392 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 364 PEPKPEPKPEPKPEPKPYPEPKPEPKPKPKPEP 396 >05_03_0039 - 7621613-7622695 Length = 360 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P + P P P P P P P P P P P Sbjct: 184 PKPKPVPHPEPKPEPKPEPKPHPEPKPEPKPEP 216 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P + P P P P P P P P P P P Sbjct: 268 PEPKPVPKPKPIPHPGPKPKPKPDPKLEPKPHP 300 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 150 PEPKPYPKPKPEPKPGPKPEPKPEPKPHPEPKP 182 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 104 PNPEPKPEPKPEPKPEPKPYPEPKPKPKPEPKP 136 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 116 PKPEPKPYPEPKPKPKPEPKPEPKPEHKPEPKP 148 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 124 PEPKPKPKPEPKPEPKPEHKPEPKPEPEPKPYP 156 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 138 PKPEHKPEPKPEPEPKPYPKPKPEPKPGPKPEP 170 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 148 PEPEPKPYPKPKPEPKPGPKPEPKPEPKPHPEP 180 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 154 PYPKPKPEPKPGPKPEPKPEPKPHPEPKPEPKP 186 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 158 PKPEPKPGPKPEPKPEPKPHPEPKPEPKPKPVP 190 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 170 PKPEPKPHPEPKPEPKPKPVPHPEPKPEPKPEP 202 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 182 PEPKPKPVPHPEPKPEPKPEPKPHPEPKPEPKP 214 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 228 PEPEPKLKPEPKPEPKPEPEPKPEPKPEPKPEP 260 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 230 PEPKLKPEPKPEPKPEPEPKPEPKPEPKPEPKP 262 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 244 PEPEPKPEPKPEPKPEPKPYPKPKPEPKPVPKP 276 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 252 PKPEPKPEPKPYPKPKPEPKPVPKPKPIPHPGP 284 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 260 PKPYPKPKPEPKPVPKPKPIPHPGPKPKPKPDP 292 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +1 Query: 826 PXPXXLXXP---PXPXPSPXXXPXPXPPXXPXPXP 921 P P + P P P P P P P P P P P Sbjct: 274 PKPKPIPHPGPKPKPKPDPKLEPKPHPEPKPHPMP 308 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 288 PKPDPKLEPKPHPEPKPHPMPEPEPKPKPEPKP 320 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 298 PHPEPKPHPMPEPEPKPKPEPKPEPKPYPEPKP 330 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 100 PEPKPNPEPKPEPKPEPKPEPKPYPEPKPKPKP 132 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 102 PKPNPEPKPEPKPEPKPEPKPYPEPKPKPKPEP 134 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 106 PEPKPEPKPEPKPEPKPYPEPKPKPKPEPKPEP 138 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 136 PEPKPEHKPEPKPEPEPKPYPKPKPEPKPGPKP 168 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 144 PEPKPEPEPKPYPKPKPEPKPGPKPEPKPEPKP 176 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 146 PKPEPEPKPYPKPKPEPKPGPKPEPKPEPKPHP 178 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 156 PKPKPEPKPGPKPEPKPEPKPHPEPKPEPKPKP 188 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 168 PEPKPEPKPHPEPKPEPKPKPVPHPEPKPEPKP 200 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 172 PEPKPHPEPKPEPKPKPVPHPEPKPEPKPEPKP 204 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 178 PEPKPEPKPKPVPHPEPKPEPKPEPKPHPEPKP 210 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 192 PEPKPEPKPEPKPHPEPKPEPKPEPKLHPKPEP 224 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 200 PEPKPHPEPKPEPKPEPKLHPKPEPKPHPEPEP 232 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 236 PEPKPEPKPEPEPKPEPKPEPKPEPKPYPKPKP 268 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 240 PEPKPEPEPKPEPKPEPKPEPKPYPKPKPEPKP 272 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 242 PKPEPEPKPEPKPEPKPEPKPYPKPKPEPKPVP 274 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 246 PEPKPEPKPEPKPEPKPYPKPKPEPKPVPKPKP 278 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 250 PEPKPEPKPEPKPYPKPKPEPKPVPKPKPIPHP 282 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 296 PKPHPEPKPHPMPEPEPKPKPEPKPEPKPYPEP 328 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 306 PMPEPEPKPKPEPKPEPKPYPEPKPKLKPEPKP 338 >04_03_0904 + 20717005-20718087 Length = 360 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXP---PXXPXPXPP 924 P P P P P P P P P P P P PP Sbjct: 141 PTPPTYKPQPKPTPPPTYKPQPKPTPTPYTPTPTPP 176 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P P P P P P P P Sbjct: 285 PTPTPYTPTPKPNPPPTYKPQPKPTPTPTPYKP 317 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXX-PXPXPPXX-PXPXPP 924 P P P P PSP P P PP P P PP Sbjct: 310 PTPTPYKPQPKPTPSPYTPKPTPTPPTYTPTPTPP 344 >04_03_0747 - 19251617-19251781,19252377-19252502,19252606-19252716, 19252931-19253679,19254034-19254167,19254595-19254740, 19255166-19255336,19255977-19256828 Length = 817 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P P P P P P Sbjct: 128 PPPPPPPPARTPMPTPTPTPTPTP 151 >01_06_1758 - 39681942-39682030,39682115-39682345,39682643-39682679, 39683604-39683835,39683937-39684022,39684126-39684218, 39684302-39684465,39684541-39684702,39684783-39684962, 39685079-39685515,39685614-39685669 Length = 588 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG G GG GG G Sbjct: 62 GRGRGGGAGGGGWGRGGGGGGGAGGYRGGGGRG 94 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P + PPPP PPP P Sbjct: 414 PPPTHTHGPPPPPPPPPP 431 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPP PPP P Sbjct: 413 PPPPTHTHGPPPPPPPPP 430 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PP P PPP PP P PP Sbjct: 354 PPAPPPPPPFAPTLPPPPPPRRKPP 378 >01_06_1377 + 36764461-36765339 Length = 292 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P SP P P PP P PP Sbjct: 155 PPPPEPQYPP-PSSSPYYFPPPPPPAYSAPPPP 186 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P PP PPPP PPP Sbjct: 40 PVPPPPGVPPPPPPPP 55 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +2 Query: 827 PXPPXSXXPPP----PXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPP PPP P P P PP Sbjct: 967 PPPPPNVAPPPFTRQDIPPPPPSPPPLPITQPPSVPP 1003 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P P PP Sbjct: 985 PPPPSPPPLPITQPPSVPPPPNSPP 1009 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PXPXPSPXXXPXPXPPXXPXPXPP 924 P P PS P P P P P PP Sbjct: 22 PAPSPSSSSAPAPASPRSPVPPPP 45 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 859 PXPSPXXXPXPXPPXXPXPXPP 924 P P+ P P PP P P PP Sbjct: 32 PAPASPRSPVPPPPGVPPPPPP 53 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXP 915 P P P P PSP P PP P P Sbjct: 975 PPPFTRQDIPPPPPSPPPLPITQPPSVPPP 1004 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P Sbjct: 201 PKPGPKPKPKPPKPGPKPKPGPPQPWWPIPFP 232 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P P P P P P Sbjct: 172 PKPGPKPKPPKPGPKP-KPPKPGPKPKPKPPKP 203 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPP-XXPXPXPP 924 P P P P P P P PP P P PP Sbjct: 157 PKPGPKPKPKPSPPKPKPGPKPKPPKPGPKPKPP 190 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P P P P P P Sbjct: 161 PKPKPKPSPPKPKPGPKPKP-PKPGPKPKPPKP 192 >10_08_0221 - 15980370-15980927 Length = 185 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 879 GXGGGXGGGGXXEXGGXG 826 G GGG GGGG GG G Sbjct: 30 GGGGGGGGGGGGSNGGSG 47 Score = 25.0 bits (52), Expect(2) = 3.0 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 879 GXGGGXGGGGXXEXGGXG 826 G GGG GGGG + GG G Sbjct: 68 GDGGGGGGGG-GQNGGSG 84 Score = 23.4 bits (48), Expect(2) = 3.0 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG 853 GG G GG G G G G G Sbjct: 32 GGGGGGGGGGSNGGSGWGSGSGSG 55 >10_08_0880 + 21267034-21267537 Length = 167 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG GGG GGGG G Sbjct: 50 GGGYGGGSGGYGGGGSSGGGYGGGGGSSTSG 80 >10_08_0217 - 15962192-15962884 Length = 230 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG G G Sbjct: 62 GGSGGAYASGGGGGGGGGGGQNGGSGYG 89 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 PP P PP PP P PP P P Sbjct: 55 PPAVVAPSPPLPPLTPPPAIVPPALPPPPP 84 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PP P PP PP P PP Sbjct: 40 PPAPTVVAPPLPTTPPPAVVAPSPPLPPLTPPP 72 >09_04_0180 + 15367737-15367755,15368874-15369739 Length = 294 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P Sbjct: 138 PIPTPSPRPRPPDPEPKPDPEPDPELEPEPEP 169 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P Sbjct: 146 PRPPDPEPKPDPEPDPELEPEPEPEPDPEPEP 177 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P P P P P P P Sbjct: 140 PTPSPRPRPPDPEPKPDPEPDPELEPEPEPEP 171 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P P P PP P P P Sbjct: 133 PPRPMPIPTPSPRPRPP-DPEPKP 155 >09_02_0601 + 11112201-11112386,11112471-11114080,11114345-11114579, 11115233-11115358 Length = 718 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P P P PP P P Sbjct: 411 PAPPSPPEPPSPRHPSSPPPLRSPPRQPTPPP 442 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P P P P PP P PP Sbjct: 417 PEPPSPRHPSSPPPLRSPPRQPTPPPSPSQQPP 449 >08_02_1256 + 25645085-25645396 Length = 103 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPP 901 PPPP PPP P PP Sbjct: 62 PPPPPPPPLPSPPPPPP 78 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPP PPP PP Sbjct: 64 PPPPPPLPSPPPPPPPQQQEEQSPP 88 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXP 910 S PPP PPP P PP P Sbjct: 57 SSQQPPPPPPPPPLPSPPPPPPP 79 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PPPP PP PP Sbjct: 65 PPPPPLPSPPPPPPPQQQEEQSPPP 89 >08_02_1084 - 24232968-24234779 Length = 603 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PPP P PP PP Sbjct: 54 PPSQQLPPPSLPPPLP--QKQPPSQQLPPPP 82 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +2 Query: 833 PPXSXXPPPP--XPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PP PP P PP Sbjct: 73 PPSQQLPPPPQQQQPPPQHSLPPPPPLPQAPPP 105 >08_02_0839 + 21693348-21694853 Length = 501 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXP 910 P PPPP PP P PP P Sbjct: 24 PLPYLPPPPPPPQPPLLQLQPPPPP 48 >07_01_0037 + 301864-302349 Length = 161 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGGG GG G Sbjct: 18 GGGADGNAGGGVTSAGAAGG-GGGGTRASGGGG 49 >06_01_0760 - 5676973-5677830 Length = 285 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG + GG G Sbjct: 103 GPYGGGAYAQGEGGG-GGGGGGQNGGSG 129 >06_01_0690 + 5033943-5034740 Length = 265 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG + GG G Sbjct: 142 GPYGGGAYAQGGGGG-GGGGGGQNGGSG 168 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG G G Sbjct: 182 GPYGGGYAQGGGGGGGGGGGQNGGSGYG 209 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGX---GGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG + GG G Sbjct: 92 GSGYGQAGGYGPYGGYAQGGGGGGGGGGGQNGGSG 126 >05_01_0210 + 1583176-1584177 Length = 333 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPP 901 PPPP PPP P PP Sbjct: 32 PPPPPPPPPPLLPADPP 48 >04_04_0592 + 26477974-26479311 Length = 445 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P+ P P PP P P PP Sbjct: 86 PPPPTPTTTTTPTPTPP-LPPPAPP 109 >04_02_0026 + 8708765-8710935,8711021-8711272,8711353-8711463, 8711553-8711634,8711909-8712100 Length = 935 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P P P PP P P Sbjct: 481 PAPPSPPEPPSPRHQPSPPPLRSPPRQPTPPP 512 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P P P P PP P PP Sbjct: 487 PEPPSPRHQPSPPPLRSPPRQPTPPPSPSQQPP 519 >04_01_0354 - 4646826-4647314 Length = 162 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P + PPPP PPP P Sbjct: 85 PLPNLNLSPPPPPPPPPP 102 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P PP P P PP Sbjct: 81 PRPHPLPNLNLSPPPPPPPPPPPP 104 >03_05_0252 - 22403504-22404676 Length = 390 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG G GG GG G Sbjct: 6 GGGGGRAGRVGGGGGGGAGGGGGGGGGG 33 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGGG G Sbjct: 8 GGGRAGRVGGGGGGGAGGGGGGGGGGAAAAAAG 40 >03_02_0865 - 11895257-11895340,11896004-11896069,11896297-11896355, 11896470-11896557,11897158-11897328,11897406-11897564, 11897653-11897835,11897931-11898012,11898753-11898959, 11899099-11899170,11901948-11902055,11902460-11902506 Length = 441 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXP 898 P P PPPP PPP P P Sbjct: 194 PLPSQVPAPPPPPPPPQPSAANKP 217 >03_02_0342 - 7645323-7645909,7646323-7646491 Length = 251 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P P PP P P P PP Sbjct: 174 PPPPPPRPPAPEYKPPTPTLTPIPTPEPSYGPP 206 >02_04_0264 - 21393029-21393046,21394249-21394814,21395005-21395623 Length = 400 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GG G GG G Sbjct: 275 GGAGAGA-GGARGGAGAGGGHGGAGAGAGGGRG 306 >02_04_0140 - 20156655-20156834,20157139-20159345,20159970-20160042 Length = 819 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP + P PP PPP P Sbjct: 6 PEPPPNPTPVPPPPPPAP 23 >02_03_0279 + 17250347-17252098 Length = 583 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P P PP Sbjct: 125 PPPPPPPPPPPPLFAKPDLDSTAPP 149 >02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410, 9392400-9392759 Length = 354 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPP 901 PPPP PPP P PP Sbjct: 38 PPPPPPPPPPSQPSAPP 54 >02_01_0017 - 112766-113650 Length = 294 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPP 901 PPPP PPP P PP Sbjct: 61 PPPPTPPPRPTTTTNPP 77 >01_01_0445 - 3319451-3320035 Length = 194 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPP PPP P Sbjct: 29 PPPPPQHTPPPSPPPPAP 46 >01_01_0082 + 625198-625719 Length = 173 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P+P P P P P P PP Sbjct: 55 PPDVLPTPVYYPPPPPVYYPPPSPP 79 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P + PP P P P P P P P PP Sbjct: 66 PPPPPVYYPP-PSPPPVAYPPPTTPSTNCPPPP 97 >03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468, 5935582-5935616,5935694-5935769,5936552-5936662, 5937001-5937087,5937302-5937395,5937489-5937606, 5938047-5938542,5939263-5939298,5940047-5940578, 5940668-5940792 Length = 703 Score = 24.6 bits (51), Expect(2) = 4.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP 871 P PP S PPPP P Sbjct: 553 PPPPKSMPPPPPKFP 567 Score = 23.0 bits (47), Expect(2) = 4.5 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPP 901 PP PPP P PP Sbjct: 587 PPKSMPPPPPKSMPPPP 603 >12_01_0495 - 3935395-3937110 Length = 571 Score = 29.1 bits (62), Expect = 5.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PP P Sbjct: 5 PPPPLPPPPPPPPPPATP 22 >10_08_0236 + 16078162-16078731 Length = 189 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GGG GGGG + GG G Sbjct: 105 GGYGGESDAGGGGGGGGQGQAGGYG 129 >10_02_0009 + 4128909-4130123 Length = 404 Score = 29.1 bits (62), Expect = 5.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PP P Sbjct: 79 PSPPSPPPPPPPPPPQQP 96 >08_01_0060 - 413088-413999 Length = 303 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P P P Sbjct: 29 PPPP----PPPPPPPPLPFHLHHHPLDP 52 >07_03_0435 + 18182657-18183509,18184477-18184574,18184663-18184833, 18185524-18185624,18185702-18185837,18186007-18186057, 18186202-18186489,18186610-18186844,18186924-18187204, 18187336-18187557 Length = 811 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXP 910 S P PP PPP P PP P Sbjct: 74 SVMPQPPPPPPPPATSRRPPRAP 96 >06_03_1121 + 27767707-27768065,27768612-27769034,27770013-27770175, 27770271-27770381,27770895-27770963,27771117-27771203, 27771967-27772752 Length = 665 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 879 GXGGGXGGGGXXEXGGXG 826 G GGG GGGG + GG G Sbjct: 34 GVGGGGGGGGPGDGGGHG 51 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP + PPP PP P PP Sbjct: 41 PPPPGAYPPPPGAYPPPPGAYPPPP 65 >04_04_1628 + 34874688-34874915,34875182-34875232,34875532-34875652, 34875739-34875788,34876395-34876524,34877007-34877170, 34877262-34877300,34877301-34877464,34877808-34877931, 34878002-34878103,34878208-34878297 Length = 420 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXE 841 GG G G G GGG GGGG E Sbjct: 3 GGDGGGGGGDESEFVGVGGGGGGGGEGE 30 >04_04_1536 - 34207425-34207490,34207801-34208268,34208345-34208485, 34208582-34208820,34209950-34210436 Length = 466 Score = 29.1 bits (62), Expect = 5.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXP 909 PP P P+P P P PP P Sbjct: 363 PPKPSPTPPTPPTPPPPSAP 382 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 29.1 bits (62), Expect = 5.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P PPPP PPP P Sbjct: 19 PPAPAPVPPPPPPPPPPP 36 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P PPPP PPP P Sbjct: 20 PAPAPVPPPPPPPPPPPP 37 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXP 898 P + PPPP PPP P P Sbjct: 20 PAPAPVPPPPPPPPPPPPANVP 41 >04_04_0176 - 23329589-23331043 Length = 484 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P P P P P P PP Sbjct: 65 PSPGHSALSPSPPPPPRRGPLPDPTAKAEPEPP 97 >02_05_1057 + 33809982-33810366,33810436-33810687,33810727-33810926, 33811021-33811122 Length = 312 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 68 GGCGGGCGGENDDTGNGGGGGGGGG--GGGAG 97 >01_01_0046 - 331758-332627 Length = 289 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP PP P P Sbjct: 24 PPPPPPPPPSSSRYRPPSPPSSRHP 48 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXP 910 S PPPP PPP P P P Sbjct: 20 SPPPPPPPPPPPPSSSRYRPPSP 42 >09_02_0351 - 7686974-7686983,7687142-7687195,7687363-7687408, 7688179-7688280,7688683-7689284,7689599-7689783 Length = 332 Score = 24.2 bits (50), Expect(2) = 6.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 842 SXXPPPPXPPP 874 S PPPP PPP Sbjct: 67 SRRPPPPPPPP 77 Score = 23.0 bits (47), Expect(2) = 6.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 854 PPPXPPPXP 880 PPP PPP P Sbjct: 70 PPPPPPPPP 78 >11_03_0163 - 10970459-10970725 Length = 88 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXE 841 G G GG G GGG GGGG E Sbjct: 61 GRRWLGGEGGGVGGGGGGGGAGGGGSRE 88 >10_08_0242 - 16120554-16121129 Length = 191 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G GGG GGGG + GG G Sbjct: 55 GTGSGRSGYNGAHASGGGGGGGGGYSQYGGSG 86 >10_08_0215 - 15939842-15940056,15940235-15940913 Length = 297 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 897 GXXXXXGXGGGXGGGGXXEXGG 832 G G GGG GGGG E GG Sbjct: 33 GVEVGSGGGGGGGGGGSSENGG 54 >10_07_0107 - 12936839-12937030,12937305-12937386,12937476-12937586, 12937667-12937918,12938004-12940237,12940328-12940525 Length = 1022 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PP P P P PP P P Sbjct: 568 PAPPSPPEPPSPRHLPSPPPLRSPPRQPTPPP 599 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P P PP P PP Sbjct: 218 PQPPPSSLIPPVLPLPLLNPPPPPPPPPSLLPP 250 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PPP PPP P P P P Sbjct: 228 PVLPLPLLNPPPPPPPPPSLLPPVPLLPPLIP 259 >08_02_1019 - 23657175-23658047 Length = 290 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG GGG GGGG GG G Sbjct: 31 GLGGGGGGVPKPGGGVGGGGGGGGGGGG 58 >07_03_0471 + 18501496-18502104,18503009-18503260,18503367-18503537, 18503693-18503743,18503868-18503960,18504125-18504220, 18504318-18504368,18504452-18504570,18504909-18505017, 18505391-18505513,18505590-18505661,18505963-18506034, 18506125-18506191,18506260-18506402,18506494-18506565, 18506632-18506760,18507317-18507472,18507579-18507692, 18507791-18507889,18507974-18508051,18508402-18508536, 18509081-18509155,18509247-18509361,18509458-18509828, 18509903-18509965,18510049-18510120,18510285-18510413, 18510512-18510628,18510902-18511018 Length = 1289 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P P S PPPP PPP Sbjct: 74 PSPSSSSWPPPPPPPP 89 >07_01_0753 - 5799733-5799741,5799938-5800642 Length = 237 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P + PPPP PPP P P P Sbjct: 37 PAAAYAPPPPPPPPPPPPTLVFVPVTSP 64 >06_03_1506 + 30641428-30642168 Length = 246 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXX-GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG GG G Sbjct: 126 GGYGSGYDYGGQGGGGGHGGGGGGGSGYGNGGYG 159 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGG 850 G G GG G GGG GGGG Sbjct: 163 GEGYGSGGGVNGGGGSGGGGGGGG 186 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 897 GXXXXXGXGGGXGGGGXXEXGGXG 826 G G GGG GGGG GG G Sbjct: 196 GYGKGYGYGGGPGGGGGGAGGGGG 219 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GG GGGG G G Sbjct: 198 GKGYGYGGGPGGGGGGAGGGGGGGSYNGGTGG 229 >06_01_0586 - 4203024-4203425,4203527-4203595,4203681-4203746, 4204006-4204071,4204642-4204719,4204811-4205233 Length = 367 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 GG GG G GGG GGGG G Sbjct: 243 GGGGKASKGGTGGEGGGGGGGGGGGGTGGG 272 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,822,685 Number of Sequences: 37544 Number of extensions: 253940 Number of successful extensions: 16581 Number of sequences better than 10.0: 295 Number of HSP's better than 10.0 without gapping: 2813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9346 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2647531240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -