BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G23 (928 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 44 1e-04 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 40 0.003 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 37 0.027 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 36 0.035 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 36 0.061 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 36 0.061 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 36 0.061 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 36 0.061 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 0.072 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 35 0.11 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 34 0.19 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 33 0.25 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 33 0.25 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 33 0.25 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 33 0.25 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 33 0.33 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 33 0.43 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 33 0.43 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 33 0.43 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 32 0.57 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 32 0.57 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 32 0.76 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 32 0.76 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 32 0.76 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.76 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 32 0.76 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 31 1.0 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 31 1.0 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 31 1.0 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 31 1.3 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 31 1.3 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 31 1.3 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 31 1.7 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 31 1.7 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 31 1.7 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 30 2.3 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 30 2.3 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 30 2.3 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 30 2.3 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 30 3.1 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 30 3.1 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 29 4.0 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 29 4.0 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 29 4.0 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 29 5.3 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 29 5.3 SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 29 5.3 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 29 5.3 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_19554| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 28 9.3 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 28 9.3 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 28 9.3 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 28 9.3 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP PPP P PP P PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 42.7 bits (96), Expect = 4e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPP PPP P PP P PP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P PSP P P PP P P PP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP PPP P PP P P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPP 397 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP P PP P PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP P PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP P PP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P P P PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 36.7 bits (81), Expect = 0.027 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P PP P PP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPP 391 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P PP PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PP P PP P PP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PP P PP P PP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP P P P PP P PP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP PP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 31.9 bits (69), Expect = 0.76 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PPP P P PP Sbjct: 409 PPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP P PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP PPP P PP PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPP 707 Score = 33.5 bits (73), Expect = 0.25 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P + PP P P P P P PP P PP Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPPP P P P P P Sbjct: 698 PPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P L PP P P P P P PP P P P Sbjct: 127 PPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPP-PNPPPPNAPYPPPPYPPPPNP 185 Query: 922 P 924 P Sbjct: 186 P 186 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP PPP PP P PP Sbjct: 167 PPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P P PP P P PP Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 36.3 bits (80), Expect = 0.035 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPX-PSPXXXPXPXPPXXPXPX 918 PP P PP P P PP P P+P P P P P P Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPP 235 Query: 919 PP 924 PP Sbjct: 236 PP 237 Score = 35.1 bits (77), Expect = 0.081 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP PP Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 35.1 bits (77), Expect = 0.081 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP PP P PP Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 35.1 bits (77), Expect = 0.081 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP-PXPXXXXXPPXXPXXXPP 925 P PP + PPPP PP P P PP PP Sbjct: 117 PPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPP 150 Score = 35.1 bits (77), Expect = 0.081 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP PP P PP Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 35.1 bits (77), Expect = 0.081 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PPP PP P PP Sbjct: 183 PNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PP P PP P PP Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXP--PPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXP-PPXPXXXXXPPXXPXXXPP 925 P PP P PP P PP P PP P PP Sbjct: 165 PNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 33.5 bits (73), Expect = 0.25 Identities = 20/72 (27%), Positives = 21/72 (29%) Frame = +1 Query: 709 ARCGXLSSXXXPPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPX 888 A+CG P P PP P P PP P P P Sbjct: 78 AKCGGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNP-----PY 132 Query: 889 PXPPXXPXPXPP 924 P PP P P P Sbjct: 133 PPPPNAPYPPSP 144 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P PP Sbjct: 90 PNPPY---PPPPYPPYPPPPPYPPPPNPPYPPP 119 Score = 33.1 bits (72), Expect = 0.33 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PP P P P P P+P P P P P P P Sbjct: 169 PPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNA---PNPPPPNPPYPPPPNAPNPPYPPP 225 Query: 922 P 924 P Sbjct: 226 P 226 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP + PP P PP P PP P Sbjct: 212 PPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXP 915 PP P PP P P P P P P P P P P P Sbjct: 182 PPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = +2 Query: 827 PXPPXSXXPPPPX---PP-PXPXXXXXPPXXPXXXP 922 P PP PPPP PP P P PP P P Sbjct: 204 PPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P PP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 36.7 bits (81), Expect = 0.027 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PPP P PP P PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 36.3 bits (80), Expect = 0.035 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PPPP P P P PP P PP Sbjct: 209 PRPPPSPPPPPPPPSPSP---PRPPPPPPPSPP 238 Score = 35.1 bits (77), Expect = 0.081 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXP 915 P P PP P PSP P P PP P P Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PPP P P P PP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PPP PP P PP P PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPP 227 Score = 31.9 bits (69), Expect = 0.76 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP-PXPXXXXXPPXXPXXXP 922 P PP PPPP PP P PP P P Sbjct: 224 PSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S PP P PPP P P PP Sbjct: 218 PPPPPSPSPPRP-PPPPPPSPPRPLAAKLPEPP 249 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P P PPP P PP P PP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 35.1 bits (77), Expect = 0.081 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P P P Sbjct: 307 PPPPGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 35.1 bits (77), Expect = 0.081 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P P + PPPP PPP P PP P Sbjct: 308 PPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 33.5 bits (73), Expect = 0.25 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + P PPP P PP P PP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 306 PPPPPGGAPPPPPPPPPP-----PPGDGGAPPP 333 Score = 31.9 bits (69), Expect = 0.76 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P P PP Sbjct: 305 PPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP PPP P P PP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP P PP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP P PP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P P PP P P PP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 34.3 bits (75), Expect = 0.14 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP S PPPP PPP P Sbjct: 1165 PPPPSSPSPPPPPPPPPP 1182 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P P P PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPP 1181 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXP 921 PP P PS P P PP P P P Sbjct: 1163 PPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP P P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG + G Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDG 804 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 840 GGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG + GG G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYG 808 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG + GG G Sbjct: 805 GGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFG 837 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGG 801 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG + GG G Sbjct: 799 GGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGG 800 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG GG G Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 797 GGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GGG GGGG GG G Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG + G G Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGG 814 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 GG G GG G GGG GGGG G Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG GG Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG GG G Sbjct: 831 GDGGGFGDGGGYADGDGGGGGGGGGGGGGGGG 862 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG GG G Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G GGG GGGG GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGG 801 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GGG GGGG G G Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGG 805 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG G G Sbjct: 774 GDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G + GG G Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGG 816 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGGG G G Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G GGG GGGG GG G Sbjct: 834 GGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGG 866 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G GGG GGGG GG G Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGG 865 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGG 113 Score = 31.9 bits (69), Expect = 0.76 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGGGGG-GGGFG 120 Score = 31.9 bits (69), Expect = 0.76 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGGG GG G Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 GG G GG G GGG GGGG G Sbjct: 99 GGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGG GG G Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGG 117 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 689 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 692 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG G G Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 27.5 bits (58), Expect(2) = 0.072 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P P + PPPP PPP Sbjct: 372 PCAPFAPPPPPPPPPP 387 Score = 26.6 bits (56), Expect(2) = 0.072 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXP 898 PPPP PPP P P Sbjct: 379 PPPPPPPPPPAPGSTP 394 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P + PPPP PPP PP P PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PPPP PPP PP P P Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 28.7 bits (61), Expect = 7.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P PP S P PP PPP Sbjct: 87 PPPPASNVPAPPPPPP 102 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = +2 Query: 827 PXPPXSXXPPP------PXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPP P PPP P PP P PP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPP 395 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = +2 Query: 827 PXPPXSXXPPP------PXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPP P PPP P PP P PP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 405 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = +2 Query: 827 PXPPXSXXPPP------PXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPP P PPP P PP P PP Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P P P P PP P PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPP 378 Score = 31.9 bits (69), Expect = 0.76 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP PP PP Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP PP PP Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 5/38 (13%) Frame = +2 Query: 827 PXPPXSXXPPPPXP-----PPXPXXXXXPPXXPXXXPP 925 P PP + P PP P PP P PP P P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGP 384 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP PPP PP PP Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPP 387 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP P PP PP Sbjct: 188 PPPPSGGPPPPPPPPPPP---PPPPILELAAPP 217 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPPP PPP P P P Sbjct: 195 PPPPP---PPPPPPPPPPILELAAPPPP 219 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +1 Query: 742 PPXXPXPPXXXXXXXXXXXXXXXXXXXXPXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 PP P P P PP P P P P PP P P P Sbjct: 152 PPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGP---PPPPPPPPPPPPP 208 Query: 922 P 924 P Sbjct: 209 P 209 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP--XPXXXXXPPXXPXXXPP 925 P P PPPP PPP P PP P PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P PP P PP Sbjct: 200 PPPPPGFPGGAPPPPPPPFGAPPPP 224 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGG 1790 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 GG G GG G GGG GGGG Sbjct: 1820 GGEGMGAAGGGMGAGGEGGGAGGGG 1844 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -2 Query: 924 GGXXXGXXG-GXXXXXGXGGGXGGGGXXEXGG 832 GG G G G G GGG GGGG GG Sbjct: 1789 GGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGG 1820 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG G GG E GG G Sbjct: 1811 GGGGGGMGGGGEGMGAAGGGMGAGG--EGGGAG 1841 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 897 GXXXXXGXGGGXGGGGXXEXGGXG 826 G G GGG GGGG GG G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGG 1779 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG E GG Sbjct: 82 GGCGGGGGGGGGVGGGGGGGGGGGDDCEDGG 112 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG GG G GGG GGGG GG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGG 104 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 82 GGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 GG G GG G GGG GGGG + G Sbjct: 90 GGGGDGDGGGGGD--GGGGGDGGGGNDDDG 117 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP + PPPP PPP P P Sbjct: 426 PPPPPAPLPPPPPPPPQPTTALPDP 450 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP P PP PPP P Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 81 GGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 31.9 bits (69), Expect = 0.76 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG GG G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGG 91 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGG---XGGGGXXEXGGXG 826 GG G GG G GGG GGGG + GG G Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG + G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGG 89 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG + G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGG 90 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 GG G GG G GGG GGGG Sbjct: 88 GGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXG--GGXGGGGXXEXGGXG 826 GG G GG G G GG GGGG GG G Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GGG GGG GG G Sbjct: 80 GGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 G G GG G GGG GGGG G Sbjct: 86 GDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGGG GG Sbjct: 97 GGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 GG G GG G GGG GGGG + G Sbjct: 105 GGGGDGDGGGGGD--GGGGGDGGGGNDDDG 132 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPP 901 PP PPPP PPP P PP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPP 118 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PPP P Sbjct: 102 PPPPPPPPPPPPPPPPPP 119 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PPP P Sbjct: 103 PPPPPPPPPPPPPPPPPP 120 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P PP P P PP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +2 Query: 827 PXPPXSXXP-----PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PPP PPP P PP P P Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 32.3 bits (70), Expect = 0.57 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP PPP P P P PP P P Sbjct: 717 PPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P P P PP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPP 718 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +2 Query: 827 PXPPX---SXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP + PPP PPP P PP P P Sbjct: 700 PPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P P PP Sbjct: 692 SVPPPPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P P PP Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPPP 720 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PP PPP P PP P PP Sbjct: 75 PPPPAAPPAAPPPPPPLP-APPPPPAQPAPQPP 106 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PP P P PP P PP Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P +P P P PP P PP Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P + PPPP P P P P PP Sbjct: 78 PAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG GG G Sbjct: 226 GGFGGGGGVWGNGGGGGGGGGYSGGGSG 253 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 32.7 bits (71), Expect = 0.43 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PPP P Sbjct: 974 PPPPGGSAPPPPPPPPPP 991 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P S PPPP PPP P Sbjct: 975 PPPGGSAPPPPPPPPPPP 992 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PP PPP PP P PP Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 3/31 (9%) Frame = +2 Query: 827 PXPPXSXXPPPPXPP---PXPXXXXXPPXXP 910 P PP PPPP PP P PP P Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPP 975 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +2 Query: 827 PXPPXSXXPPPP---XPP-PXPXXXXXPPXXPXXXPP 925 P PP PPP PP P P PP P PP Sbjct: 955 PPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P P PPP PP PP Sbjct: 922 PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPP 954 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P PP PP PP PP Sbjct: 923 PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPP 955 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +2 Query: 827 PXPPXSXXPPPP---XPPPXPXXXXXPPXXP 910 P PP + PPPP PPP P PP P Sbjct: 210 PLPPTAAPPPPPTTGAPPPTPVTNKPPPPRP 240 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXP 898 PP S PPPP PPP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 859 PXPSPXXXPXPXPPXXPXPXPP 924 P SP P P PP P P PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P PPPP PPP P Sbjct: 1308 PESPPPPPPPPPPPPPPP 1325 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PP P Sbjct: 1311 PPPPPPPPPPPPPPPLPP 1328 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PP P Sbjct: 1313 PPPPPPPPPPPPPLPPTP 1330 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PP P PP PP Sbjct: 477 PPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 31.9 bits (69), Expect = 0.76 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP P PP PP P PP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPP 460 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGGG + GG Sbjct: 322 GGGGGYGGGRGGGRGYGGGRGGGGRRDYGG 351 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 GG G GG G GGG GGGG G Sbjct: 109 GGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG GGG GGG + GG Sbjct: 114 GGYGGGRGGGGYGGGRGGGGSYGGGRRDYGG 144 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 32.3 bits (70), Expect = 0.57 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P P PPPP PPP P PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PPP P Sbjct: 868 PPPPPPPPPPPPPPPPPP 885 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 859 PXPSPXXXPXPXPPXXPXPXPP 924 P P P P P PP P P PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPP 881 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P PP P P PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPP 883 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P PP P P PP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXP 898 PP PPPP PPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXP 922 PPPP PPP P PP P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P P PP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 32.3 bits (70), Expect = 0.57 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 104 GGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGG 136 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 117 GGGYGGGRGGGGYGGGRGGGYGGGRRDYGGG 147 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 32.3 bits (70), Expect = 0.57 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP PP P P Sbjct: 123 PPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVP 155 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 31.9 bits (69), Expect = 0.76 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GGG GGGG + GG G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDG 332 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG + G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDG 338 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 31.9 bits (69), Expect = 0.76 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PPP P Sbjct: 62 PIPPTLPPPPPPPPPPLP 79 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXP 880 PP PPPP PPP P Sbjct: 68 PPPPPPPPPPLPPPPP 83 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P P PP P P PP Sbjct: 59 PTVPIP-PTLPPPPPPPPPPLPPPP 82 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P P PPP PPP P PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 31.9 bits (69), Expect = 0.76 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP PPP P Sbjct: 286 PIPPTLPPPPPPPPPPLP 303 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXP 880 PP PPPP PPP P Sbjct: 292 PPPPPPPPPPLPPPPP 307 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 P P P P P P PP P P PP Sbjct: 283 PTVPIP-PTLPPPPPPPPPPLPPPP 306 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P P PPP PPP P PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 31.9 bits (69), Expect = 0.76 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P PP S PPPP PPP Sbjct: 171 PSPPPSGAPPPPPPPP 186 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 31.9 bits (69), Expect = 0.76 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG GGG GGGG + GG Sbjct: 209 GGYGGGRGGGGYGGGHGGGGYGGGGRHDYGG 239 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 GG G GG G GGG GGGG G Sbjct: 204 GGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG G G Sbjct: 196 GGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGG 227 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG G G Sbjct: 186 GGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGG 218 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXP 910 PPPP PPP P PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP P P PP P PP Sbjct: 556 PPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPP 588 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP S P PP PPP P PP Sbjct: 566 PLPP-SEDPKPPPPPPEPPEECPPP 589 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 836 PXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P + PPPP PPP PP P P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLP 684 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 827 PXPPX--SXXPPPPXPPPXPXXXXXPPXXP 910 P PP + PPP PPP P PP P Sbjct: 665 PPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP + PPP PPP P PP P Sbjct: 302 PPPPPTDFAPPP-PPPEPTSELPPPPPP 328 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGG 832 G GG G GGG GGGG + GG Sbjct: 804 GGGGGYNRGYGSGGGYGGGGYNKRGG 829 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GG GGGG GG G Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGG 280 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GG GGGG GG G Sbjct: 255 GGGGGATGGGGGATGGGGGATGGGGGATGGGGG 287 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GG GGGG GG G Sbjct: 262 GGGGGATGGGGGATGGGGGATGGGGGATGGGGG 294 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GG GGGG GG G Sbjct: 269 GGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GG GGGG GG G Sbjct: 276 GGGGGATGGGGGATGGGGGATGGGGGATGGGGG 308 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GG GGGG GG G Sbjct: 318 GGGGGATGGGVGATGGGGGATGGGGGVTGGGGG 350 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GG GGGG GG G Sbjct: 332 GGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 325 GGGVGATGGGGGATGGGGGVTGGGGGATGGGG 356 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GG GGGG GG G Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGG 266 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GG GGGG GG G Sbjct: 243 GGGATGGGGGATG--GGGGATGGGGGATGGGGG 273 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGG-XGGGGXXEXGGXG 826 G G GG G GGG GGGG GG G Sbjct: 297 GGGGGATGGGGGATGVGGGATGGGGGATGGGVG 329 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 G G GG G GGG G GG E G Sbjct: 339 GGGGGVTGGGGGATGGGGGPGSGGCGEDG 367 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXP--PXXPXXXPP 925 P PP PPPP P P P P P PP Sbjct: 458 PLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPP 492 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXG 835 GG G GG G GGG GGGG G Sbjct: 200 GGSSRGGYGGGRGGGGYGGGRGGGGGYGGG 229 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXG-GGGXXEXGG 832 G G GG G GGG G GGG + GG Sbjct: 205 GGYGGGRGGGGYGGGRGGGGGYGGGRRDYGG 235 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P P + PPPP PPP P P P Sbjct: 910 PPLPLAPEPPPPLPPPPPPIQTTRPTVP 937 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +2 Query: 851 PPPPX---PPPXPXXXXXPPXXPXXXPP 925 PPPP PPP P PP P PP Sbjct: 951 PPPPTSALPPPIPATQVPPPPLPPLPPP 978 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXP 921 P P PP P P+ P P PP P P P Sbjct: 951 PPPPTSALPP-PIPATQVPPPPLPPLPPPPPP 981 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP-XPXXXXXPPXXPXXXPP 925 P P + P P PPP P PP P PP Sbjct: 895 PTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPP 928 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG GGGG GG G Sbjct: 337 GGSGRGGGGGG----GGGGGGGGGGGGRGGGGG 365 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGGG G G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P P Sbjct: 73 PPPLCAPPPPPPPPPP-----PPPPPGAKKP 98 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P + PPPP PPP P Sbjct: 73 PPPLCAPPPPPPPPPPPP 90 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXP 910 PPPP PPP P P P Sbjct: 82 PPPPPPPPPPPPGAKKPDDP 101 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G GGG G GG G G Sbjct: 62 GGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAG 94 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGG 850 GG G GG G GGG GGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GGG GGGG GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GGG GGGG GG G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG + G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P PP P P Sbjct: 274 PPPLCAPPPPPPPPPP-----PPPPPGAKKP 299 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P + PPPP PPP P Sbjct: 274 PPPLCAPPPPPPPPPPPP 291 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXP 910 PPPP PPP P P P Sbjct: 283 PPPPPPPPPPPPGAKKPDDP 302 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P PP + PPPP PPP Sbjct: 233 PPPPPAAAPPPPPPPP 248 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPP 874 P PP + PPPP PPP Sbjct: 234 PPPPAAAPPPPPPPPP 249 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P L P P +P P P P P PP Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG G G Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASG 495 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 77 GGHGGATGGGGGATGDGGGATGGGGGATGGGG 108 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 133 GGHGGATGGHGGATGGGGGATGGGGGATGGGG 164 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GG GGGG G G Sbjct: 63 GGGGGATGGGGGATGGHGGATGGGGGATGDGGG 95 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 G G GG G GGG GGG GG Sbjct: 140 GGHGGATGGGGGATGGGGGATGGGGGATGG 169 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXP 910 P PP PPP PPP PP P Sbjct: 654 PPPPGGGMFPPPPPPPPGGGVPGPPKPP 681 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGG-GXXEXGGXG 826 G G GG G GGG GGG G + GG G Sbjct: 450 GGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDG 482 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGGG G G Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGGACG 514 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGG 832 GG G GG G GGG GGG GG Sbjct: 762 GGGYGGGGGGYRGGGGYGGGHRGGGGYGGGG 792 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PP P PP P P Sbjct: 30 PPPPPYEAPPPPPGPPGP---DGPPGFPGPQGP 59 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PP P PP P PP Sbjct: 625 PGPPGPASPPSPPGPPGPPGPKGPP 649 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PP P PP P PP Sbjct: 710 PGPPGPASPPSPPGPPGPPGPNGPP 734 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PP P PP P PP Sbjct: 795 PGPPGPASPPSPPGPPGPPGPKGPP 819 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PP P PP P PP Sbjct: 880 PGPPGPASPPSPPGPPGPPGPKGPP 904 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PP P PP P PP Sbjct: 634 PSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PP P PP P PP Sbjct: 719 PSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PP P PP P PP Sbjct: 804 PSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPP 901 P PP PP P PP P PP Sbjct: 889 PSPPGPPGPPGPKGPPGPNGCLGPP 913 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PP P PP P PP Sbjct: 1027 PPTDPPTPPPTEPPTPPPTE-PPTPPPTDPP 1056 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXP 922 PPPP PP P PP P P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPP 800 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GGGG G G Sbjct: 156 GGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGG 188 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGG-XGGGGXXEXGGXG 826 GG G GG G GGG GGGG G G Sbjct: 169 GGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRG 202 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 854 PPPXPPPXPXXXXXPPXXPXXXPP 925 PPP PPP P P P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + PPPP P PP PP Sbjct: 310 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPP 342 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +2 Query: 833 PPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P PPPP PPP PP P PP Sbjct: 257 PTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 289 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P P PP P PP PP Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPP 389 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 842 SXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 S PPPP PPP P P PP Sbjct: 681 SSAPPPPAPPPPPIGGGDPTIWVSGGPP 708 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXP 910 PPPP PP P PP P Sbjct: 755 PPPPPPPAVPGEGARPPPPP 774 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P PP P+P P PP P PP Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 8/41 (19%) Frame = +2 Query: 827 PXPPXSXXPPPPXP-------PPXPXXXXX-PPXXPXXXPP 925 P PP + PPPP P PP P PP P PP Sbjct: 222 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 262 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +2 Query: 833 PPXSXXPPPPX--PPPXPXXXXXPPXXPXXXPP 925 P PPPP PPP PP P PP Sbjct: 169 PTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 201 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP P P PP P PP PP Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPP 301 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXE 841 G G GG G GGG GGGG E Sbjct: 30 GGGHGYGGGPNGGGGGGGGGGGGGGDE 56 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P PP PPPP P P P Sbjct: 1915 PTPPREPTPPPPPPTPLP 1932 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P P PPPP PPP PP P Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPP 386 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPP PPP P PP P P Sbjct: 356 PPVGGAAPPP-PPPPPVGGPPPPPPPIEGRP 385 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PP PPP PP PP Sbjct: 316 PPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPP 348 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 4/37 (10%) Frame = +2 Query: 827 PXPPXSXXPPPP----XPPPXPXXXXXPPXXPXXXPP 925 P PP PPPP PPP PP P P Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGP 374 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP PPP P PP Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G G GGG GG G GG G Sbjct: 183 GGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYG 215 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGG 832 GG G GGG GGGG GG Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGG 146 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G GG G GGG GGG GG G Sbjct: 165 GRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYG 197 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG G G G GGGG GG G Sbjct: 189 GGYGGGGYGGGGGGYG-GSGYGGGGGYGGGGYG 220 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG GG G GGG GGG GG G Sbjct: 150 GGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGG GG G Sbjct: 175 GYGGGGYGGGGHGGGGYGGGGYGGGGGG 202 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 909 GXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G GG G GGG GGG GG G Sbjct: 180 GYGGGGHGGGGYGGGGYGGGGGGYGGSG 207 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP PPP P P PP PP Sbjct: 1055 PIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPP 1087 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 827 PXPPXSXXP-PPPXPPPXPXXXXXPPXXPXXXPP 925 P PP S P PPP P P PP P PP Sbjct: 1047 PSPPPSAVPIPPPRKPSPPPSEPAPP--PRQPPP 1078 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 851 PPPPXPPPXPXXXXXPPXXPXXXPP 925 PPPP PPP PP P P Sbjct: 6 PPPPPPPPIAAEFTAPPAPPPPPNP 30 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 P P PP P PP P PP P P Sbjct: 180 PAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETP 212 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GGG GGGG + G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDG 65 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GGG GGGG + G G Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDG 67 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 850 PPXPXPSPXXXPXPXPPXXPXPXPP 924 PP P P P P P PP PP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPP 219 >SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 900 GGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GGG GGG + GG G Sbjct: 47 GGVGDDDGGGGGCGGGDDDDDGGGG 71 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 921 GXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 G G G G GGG GGGG + G G Sbjct: 244 GDGDGDGDGDGDGDGDGGGGGGGGDGDGDGDG 275 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G G GGG GGGG GG G Sbjct: 94 GGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGG 126 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGXGGGXGGGGXXEXGGXG 826 GG G GG GGG GGGG G G Sbjct: 148 GGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGG 180 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 833 PPXSXXPPPPXPPPXPXXXXXPPXXPXXXPP 925 PP PPPP PPP P P PP Sbjct: 329 PPEVLSPPPP-PPPSEDFYSMPSSLPMPSPP 358 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 4/37 (10%) Frame = +2 Query: 827 PXPPXSXXPPPPX----PPPXPXXXXXPPXXPXXXPP 925 P PP PP PPP P PP P PP Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPP 1272 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXPXXXXXPPXXPXXXP 922 P PP P PP PP P P P P Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPP 1284 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 7/32 (21%) Frame = +2 Query: 827 PXPPXSXXPPPP-------XPPPXPXXXXXPP 901 P PP S PPPP PPP P PP Sbjct: 320 PAPPPSQAPPPPKTIPSTLPPPPVPSATSAPP 351 >SB_19554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 28.7 bits (61), Expect = 7.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 827 PXPPXSXXPPPPXPPPXP 880 P P PPPP PPP P Sbjct: 110 PPKPTVATPPPPLPPPMP 127 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 827 PXPPXSXX--PPPPXPPPXPXXXXXPPXXPXXXPP 925 P PP + P P PP P PP P PP Sbjct: 165 PAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPP 199 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 28.3 bits (60), Expect = 9.3 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = -2 Query: 924 GGXXXGXXGGXXXXXGX-----GGGXGGGGXXEXGGXG 826 GG G GG G GGG GGG E GG G Sbjct: 114 GGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQG 151 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 879 GXGGGXGGGGXXEXGGXG 826 G GGG GGGG GG G Sbjct: 1006 GGGGGGGGGGGGRRGGRG 1023 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 826 PXPXXLXXP-PXPXPSPXXXPXPXPPXXPXPXP 921 P P P P P P P P P P P P P Sbjct: 262 PEPEPEQEPEPEPEPEPEPEPEPEPEPEPEPEP 294 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 826 PXPXXLXXPPXPXPSPXXXPXPXPPXXPXPXPP 924 P P + PP P P P P PP P PP Sbjct: 181 PAPPGVLAPP-PAPPGVLPPPPAPPGALIPPPP 212 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,034,641 Number of Sequences: 59808 Number of extensions: 148586 Number of successful extensions: 4802 Number of sequences better than 10.0: 91 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2301 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2693287426 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -