BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G22 (894 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 24 1.8 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 21 9.9 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/44 (20%), Positives = 24/44 (54%) Frame = +3 Query: 360 RCLMSGFSIFFSFLGWEHAFDDITTYIIFFAKVEQLTDFGSTFG 491 + + G ++ + + H F+ + Y ++ A + Q+++ +TFG Sbjct: 491 KTVSDGIRHYYVNVTFPHLFNGLVDYSLWKALIFQISNLQTTFG 534 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 21.4 bits (43), Expect = 9.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 455 LSKEDDVRRYVVKRVLPAKEGKENAK 378 L +E+D+ + +KRV KE N K Sbjct: 71 LDEENDINQGGLKRVSALKEKNPNLK 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,540 Number of Sequences: 336 Number of extensions: 3300 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24823920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -