BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G22 (894 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.8 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 8.7 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 2.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 649 EWXFDIRRRTRLFVRTPCFI 708 EW +R+R LF+ CF+ Sbjct: 406 EWPRLLRKRKELFIAIVCFV 425 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 2.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 649 EWXFDIRRRTRLFVRTPCFI 708 EW +R+R LF+ CF+ Sbjct: 459 EWPRLLRKRKELFIAIVCFV 478 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.8 bits (44), Expect = 8.7 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -3 Query: 256 MLNCLHRERRNPRCVARKRSNAGGQLQCVI 167 +L + +RNP V RK+S+ +L+ ++ Sbjct: 112 LLGIVDDYQRNPSVVGRKKSSGWRKLRNIV 141 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,119 Number of Sequences: 438 Number of extensions: 4133 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28904421 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -