Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP02_F_G21
         (1009 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_05_0071 - 18821475-18821609,18821691-18822065,18822142-188226...    29   7.8  

>11_05_0071 -
           18821475-18821609,18821691-18822065,18822142-18822674,
           18822776-18823331,18824593-18824621,18824970-18825018
          Length = 558

 Score = 28.7 bits (61), Expect = 7.8
 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%)
 Frame = -2

Query: 168 LQAWGWGWRKP--RPTNRAKRVKNLENMLKAQLAGXPVKGAKY 46
           LQ W W  R P  RP N  ++   +E   + +  G P+ GAK+
Sbjct: 158 LQLWSWS-RLPLGRPKNIIQKTDEVEEQEEEESDGYPIFGAKW 199


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,500,670
Number of Sequences: 37544
Number of extensions: 208450
Number of successful extensions: 5329
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1361
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2406
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2963829220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)